Identifiers and Description

Gene Model Identifier

TTHERM_00188390

Standard Name

NRK28 (NIMA-Related Kinase )

Aliases

PreTt08589 | 15.m00300 | 3697.m00012

Description

NRK28 plant dual-specificity MAP kinase kinase family domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06354.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (711 aa)
Oxytricha Contig22171.0.0.g21 5.0000898401533074e-117
Description: Protein kinase domain
DictyBase DDB_G0275241 2.0007889996237956e-71
Description: nek3 on chromosome: 2 position 4983790 to 4987279
WormBase WBGene00022631 9.996907204735647e-62
Description: locus:nekl-2 status:Confirmed UniProt:O01775 protein_id:CCD64899.1
Stentor Coeruleus SteCoe_34837 1.2479464629129513e-47
Description: None
SGD YAR018C 1.000159011384939e-43
Description: KIN3 Nonessential serine/threonine protein kinase; possible role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00188390(coding)
ATGAACCCTTATTTAGCCTAGTATTAAGAACTTGAAATTATAGGTCGAGGCAACTTTGGT
TCTGCGACATTAGTTAAAGAAATAGCTACATAGATTCTATTTATTGCTAAAAAAATTATT
TTGGCTGGACTCAAAGAAAGGGAATAGGAATCAGCGAAATAAGAAGCAGAACTTTTAAAA
AGCTTGAAGCATCCAAATATAGTAGCATATAAAGATTCCTTTATGATAGATGGTACTCTT
ATTATTATCATGGAGTATTGTGAAGAGGGTGATATTGCTTTTCACATTAAGCGCAAAAAA
AATAAATAGGAGTATTTTAGCGAGAGAGTAATTCTCAACTGGTTTTTGCAAATAGCTTTC
GCTCTCATATACATCCATGATAAAAAAATATTACATAGAGATATTAAAACTTCCAATATA
TTTGTGACATCAAACGGAACTGTTAAAATTGGAGATTTCGGTATATCAAGAGTACTTGAG
CACACACAAGATTAAGCCTAAACTGTAGTTGGAACACCCCCTGAAGTTTGTGAAAGCAAG
CCCTATACTCAAAAATCTGATGTGTGGGCTCTAGGCTGTGTCGTATACGAGCTATGCACT
TTAAAGCATGCCTTTAACTCAAACAATCTTTTAGGATTAGTATACAAGATTGTGAAAGAG
TAAGTTGAAGATATTCCTGAAATATATTCAAATGAATTAAAAAATTTAGTAAAGTAAATG
TTTATTAAAGATGATGCATTAAGACCTAATTTGCGCTAAGTTTTAGCAAGTCCCTTTTTA
ACTAAAACTATGGAAGAATTTGTGGAAAATTAGGGATAAAACATATATTAATCTGAAATT
CCAATTCGTAAAACTAATACTCATATGTAAATGCAATAGCAATAGCAATATGATGATGGA
TTAGGTGAAACTGTAAAATCTCAGCAAGCTAATGGTACATAATTTACAATAGGTCAAACT
ATAAATTCAATGTAGCAAACACAACAATAGCGCTATGATTAAACTTTAGGAGACACTGTT
TAATCTGTCAACATTCAAGGTGGAAATTTAACTGCTAAGTAAATGTTGTAAATCAAAAAG
CAATAAGAGAGCGATAAAAAGGCATAAGAGCTGACATAGGCTATAAGAGAAAATGCATCA
TTAGTAAATATTGCTAAATAGCGTAAACTAGAATAGCTAAATCATTAAAACGCAAGAGAA
AAGTAAAACATGGCTTAAACTATGTAATAATATTACAGTCAGTAACAATAGCCATAATAA
CAATACTATTCTTCAACCTAAAAATTCTATCCTCAATAAGGATAGTAAGTACCTATGAAT
AACTAAAATATGAATATGCTCACTTAGCAAATGGAAATGCTCAGCGTTTCTTAAAACACA
AACTAATTTTATAACTAGCCTTTTGATCATTCCTATCAACCTCAGTAAATGTATAACATG
CCTATAAATATGAGCCAATAGCAATAATAGAACGAATACAATTATAACTAATACAATAAC
CCTTACAATTAATAATAAGCTATGAATTAGTACTAATAACACAATGATCAGACCATAAAA
ACTGATATTTAAAATGGTAACAAATTCAATGCAACTAATAATGGGTTAGATGCATATCAA
GATGATTTCGAAGAGTATAATAGTGACTAAGAAGATGAAAAAAATAATACCTTCTCATTA
ACTGCTACATAAAACCGTCTTACTCTAAGAGCTACAGAATCTCAAAGAGAAGACGTCGTC
AACATTTATAAAGATAATCTTAAATTTAAAAACAATGATTTGGAATCTATTCATGAATAG
TCGGGAGAATATATACCTCAAACACCCCAGAAACAAGGAAAAGGAGATGTACCTTATTAA
GAAAACAAATCTTTCAACAGTAAAGTAGATAATCTAAGAAAAGAATGCATAAATTTATTA
ACAGAAGAACAATTTAATAAAGTTTATAATTTCATCAAATCTCGCGATTACATGAGTAAC
TAGGACTATTAAGAGTTAAATAAATTAGTTGGAAGAGATATAAAATCTAAATGCCAAAGG
GTAGAAGAGTTAGTTTACTTAGAAAGCATTAGTCATTGA


>TTHERM_00188390(gene)
ATGAACCCTTATTTAGCCTAGTATTAAGAACTTGAAATTATAGGTCGAGGCAACTTTGGT
AAATAAAAATTTGTTTATTAGATTTAGGATAAACCAAGCTTTTAAAAACTAGCTATTACG
TTTATCATTTTAGCTTGATAGATTAGAATCCATATTTAAATATTTATTATATAGGTTCTG
CGACATTAGTTAAAGAAATAGCTACATAGATTCTATTTATTGCTAAAAAAATTATTTTGG
CTGGACTCAAAGAAAGGGAATAGGAATCAGCGAAATAAGAAGTAAAGCCGCTTTAAAAAC
TCTTTATTTATATATTGATTATTCTTGTTATAATTTAGGCAGAACTTTTAAAAAGCTTGA
AGCATCCAAATATAGTAGCATATAAAGATTCCTTTATGATAGATGGTACTCTTATTATTA
TCATGGAGTATTGTGAAGGTAAAAAAAATATTTAAACTCTAAATTAATTTATGAATTTAA
CAATAAAGCTTTCAAATAAATACAAAATAAAAATATTTTTTTATTAATAAATAAATAACT
AATTAAAAGAGGGTGATATTGCTTTTCACATTAAGCGCAAAAAAAATAAATAGGAGTATT
TTAGCGAGAGAGTAATTCTCAACTGGTTTTTGCAAATAGCTTTCGCTCTCATATACATCC
ATGATAAAAAAATATTACATAGAGATATTAAAACTTCCAATATATTTGTGACATCAAACG
GAACTGTTAAAATTGGAGATTTCGGTATATCAAGAGTACTTGAGCACACACAAGATTAAG
CCTAAACTGTAGTTGGAACACCGTAAATATAATTCATAGATAAAAATGAAATTTATTTTT
ATATTAATTAATAGATACTATATGAGGTAGAAAGATTCACAATTTCAATTTTATAACAGC
ATAAATGAAAAAAAGAAATAGAACCATTAAAATATTAATGATTAAGATATGTTTATGCCT
TTAAAATGCATCAGTACTAAACCTAAAATAATAAATAACTCTTATTGCATTATAAATATG
AACAAAAAATTTTTATTTTTTAAAGATAATGAAAATAGATTACTTTAATTTAATTAATTT
TTATCAAATAAAGCCCTGAAGTTTGTGAAAGCAAGCCCTATACTCAAAAATCTGATGTGT
GGGCTCTAGGCTGTGTCGTATACGAGCTATGCACTTTAAAGGTATTTACTAATTAATTAT
TTCTAAAAATAGGCTAAGTAACAATTTATATTTTATATATAGCATGCCTTTAACTCAAAC
AATCTTTTAGGATTAGTATACAAGATTGTGAAAGAGTAAGTTGAAGATATTCCTGAAATA
TATTCAAATGAATTAAAAAATTTAGTAAAGTAAAATTGTTAATTTTTATTGAAAAGATGA
TGATAAAATCTATTAAAACCTTACAAAGTATAAACATTTATTTTATTTATTTATTAAAAG
GTAAATGTTTATTAAAGATGATGCATTAAGACCTAATTTGCGCTAAGTTTTAGCAAGTCC
CTTTTTAACTAAAACTATGGAAGAATTTGTGGAAAATTAGGGATAAAACATATATTAATC
TGAAATTCCAATTCGTAAAACTAATACTCATATGTAAATGCAATAGCAATAGCAATATGA
TGATGGATTAGGTGAAACTGTAAAATCTCAGCAAGCTAATGGTACATAATTTACAATAGG
TCAAACTATAAATTCAATGTAGCAAACACAACAATAGCGCTATGATTAAACTTTAGGAGA
CACTGTTTAATCTGTCAACATTCAAGGTGGAAATTTAACTGCTAAGTAAATGTTGTAAAT
CAAAAAGCAATAAGAGAGCGATAAAAAGGCATAAGAGCTGACATAGGCTATAAGAGAAAA
TGCATCATTAGTAAATATTGCTAAATAGCGTAAACTAGAATAGCTAAATCATTAAAACGC
AAGAGAAAAGTAAAACATGGCTTAAACTATGTAATAATATTACAGTCAGTAACAATAGCC
ATAATAACAATACTATTCTTCAACCTAAAAATTCTATCCTCAATAAGGATAGTAAGTACC
TATGAATAACTAAAATATGAATATGCTCACTTAGCAAATGGAAATGCTCAGCGTTTCTTA
AAACACAAACTAATTTTATAACTAGCCTTTTGATCATTCCTATCAAGTAAATCTAATCAT
TTATTTATTTATTTTTTTTTAGTTTTTATAAAAAGTATTTACTTTTAAAATATTTAAAAA
ATAGCCTCAGTAAATGTATAACATGCCTATAAATATGAGCCAATAGCAATAATAGAACGA
ATACAATTATAACTAATACAATAACCCTTACAATTAATAATAAGCTATGAATTAGTACTA
ATAACACAATGATCAGACCATAAAAACTGATATTTAAAATGGTAACAAATTCAATGCAAC
TAATAATGGGTTAGATGCATATCAAGATGATTTCGAAGAGTATAATAGTGACTAAGAAGA
TGAAAAAAATAATACCTTCTCATTAACTGCTACATAAAACCGTCTTACTCTAAGAGCTAC
AGAATCTCAAAGAGAAGACGTCGTCAACATTTATAAAGATAATCTTAAATTTAAAAACAA
TGATTTGGAATGTAAAATTTTTCTATCTAAATAATATTTTTCTATACAATTAAAATTAAC
TTACACAAAAATAAATAGCTATTCATGAATAGTCGGGAGAATATATACCTCAAACACCCC
AGAAACAAGGAAAAGGAGATGTACCTTATTAAGAAAACAAATCTTTCAACAGTAAAGTAG
ATAATCTAAGAAAAGAATGCATAAATTTATTAACAGAAGAACAATTTAATAAAGTTTATA
ATTTCATCAAATCTCGCGATTACATGAGTAACTAGGTAAGAATCTTTACTTTCGAAATGT
CATGTTTTAATTTTTTTGTTTGTTTTAAAATAGGACTATTAAGAGTTAAATAAATTAGTT
GGAAGAGATATAAAATCTAAATGCCAAAGGGTAGAAGAGTTAGTTTACTTAGAAAGCATT
AGTCATTGA


>TTHERM_00188390(protein)
MNPYLAQYQELEIIGRGNFGSATLVKEIATQILFIAKKIILAGLKEREQESAKQEAELLK
SLKHPNIVAYKDSFMIDGTLIIIMEYCEEGDIAFHIKRKKNKQEYFSERVILNWFLQIAF
ALIYIHDKKILHRDIKTSNIFVTSNGTVKIGDFGISRVLEHTQDQAQTVVGTPPEVCESK
PYTQKSDVWALGCVVYELCTLKHAFNSNNLLGLVYKIVKEQVEDIPEIYSNELKNLVKQM
FIKDDALRPNLRQVLASPFLTKTMEEFVENQGQNIYQSEIPIRKTNTHMQMQQQQQYDDG
LGETVKSQQANGTQFTIGQTINSMQQTQQQRYDQTLGDTVQSVNIQGGNLTAKQMLQIKK
QQESDKKAQELTQAIRENASLVNIAKQRKLEQLNHQNAREKQNMAQTMQQYYSQQQQPQQ
QYYSSTQKFYPQQGQQVPMNNQNMNMLTQQMEMLSVSQNTNQFYNQPFDHSYQPQQMYNM
PINMSQQQQQNEYNYNQYNNPYNQQQAMNQYQQHNDQTIKTDIQNGNKFNATNNGLDAYQ
DDFEEYNSDQEDEKNNTFSLTATQNRLTLRATESQREDVVNIYKDNLKFKNNDLESIHEQ
SGEYIPQTPQKQGKGDVPYQENKSFNSKVDNLRKECINLLTEEQFNKVYNFIKSRDYMSN
QDYQELNKLVGRDIKSKCQRVEELVYLESISH