Identifiers and Description

Gene Model Identifier

TTHERM_00189170

Standard Name

HHF2 (Histone H Four 2)

Aliases

histone H4-II gene | 15.m00378 | PreTt08667 | 3697.m00090

Description

HHF2 histone H4; Histone H4; one of the four histones (H2A- H2B- H3 and H4) that comprise the protein core of the eukaryotic nucleosome; adjacent to HHT2; encoded protein identical to Hhf1p; expressed during macronuclear and micronuclear S-phase

Genome Browser (Macronucleus)

Full Screen View


Genome Browser (Micronucleus)

Full Screen View

External Links

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and
  • ( PF02583 ) Uncharacterized BCR, COG1937
  • ( PF02969 ) TATA box binding protein associated

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12656.1 7.999439018944131e-69
Description: histone H4, minor (104 aa)
Oxytricha Contig10148.0.g40 9.995951036711152e-55
Description: Core histone H2A/H2B/H3/H4
WormBase WBGene00001888 2.9986404383886433e-43
Description: locus:his-14 Histone H4 status:Predicted UniProt:P62784 protein_id:CAB05839.1
SGD YNL030W 7.997739975804982e-43
Description: HHF2 Histone H4, core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF1); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity
DictyBase DDB_G0277183 6.001376218974307e-41
Description: H4a on chromosome: 2 position 7697697 to 7698023
Stentor Coeruleus SteCoe_3692 1.0530617357553812e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:14755052: Liu Y, Mochizuki K, Gorovsky MA (2004) Histone H3 lysine 9 methylation is required for DNA elimination in developing macronuclei in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 101(6):1679-84
  3. Ref:14536085: Clements A, Poux AN, Lo WS, Pillus L, Berger SL, Marmorstein R (2003) Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase. Molecular cell 12(2):461-73
  4. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  5. Ref:12522258: Zilberman D, Cao X, Jacobsen SE (2003) ARGONAUTE4 control of locus-specific siRNA accumulation and DNA and histone methylation. Science (New York, N.Y.) 299(5607):716-9
  6. Ref:14661947: Poux AN, Marmorstein R (2003) Molecular basis for Gcn5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates. Biochemistry 42(49):14366-74
  7. Ref:12455963: Duharcourt S, Yao MC (2002) Role of histone deacetylation in developmentally programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 1(2):293-303
  8. Ref:12351775: Jenuwein T (2002) Molecular biology. An RNA-guided pathway for the epigenome. Science (New York, N.Y.) 297(5590):2215-8
  9. Ref:12297044: Taverna SD, Coyne RS, Allis CD (2002) Methylation of histone h3 at lysine 9 targets programmed DNA elimination in tetrahymena. Cell 110(6):701-11
  10. Ref:12123289: Waterborg JH (2002) Dynamics of histone acetylation in vivo. A function for acetylation turnover? Biochemistry and cell biology = Biochimie et biologie cellulaire 80(3):363-78
  11. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
  12. Ref:11784863: Crosio C, Fimia GM, Loury R, Kimura M, Okano Y, Zhou H, Sen S, Allis CD, Sassone-Corsi P (2002) Mitotic phosphorylation of histone H3: spatio-temporal regulation by mammalian Aurora kinases. Molecular and cellular biology 22(3):874-85
  13. Ref:11972045: Dou Y, Gorovsky MA (2002) Regulation of transcription by H1 phosphorylation in Tetrahymena is position independent and requires clustered sites. Proceedings of the National Academy of Sciences of the United States of America 99(9):6142-6
  14. Ref:11135657: Tan S (2001) One HAT size fits all? Nature structural biology 8(1):8-10
  15. Ref:11467741: Green GR (2001) Phosphorylation of histone variant regions in chromatin: unlocking the linker? Biochemistry and cell biology = Biochimie et biologie cellulaire 79(3):275-87
  16. Ref:11751634: Briggs SD, Bryk M, Strahl BD, Cheung WL, Davie JK, Dent SY, Winston F, Allis CD (2001) Histone H3 lysine 4 methylation is mediated by Set1 and required for cell growth and rDNA silencing in Saccharomyces cerevisiae. Genes & development 15(24):3286-95
  17. Ref:10712850: Van Den Bussche RA, Hoofer SR, Drew CP, Ewing MS (2000) Characterization of histone H3/H4 gene region and phylogenetic affinity of Ichthyophthirius multifiliis based on H4 DNA sequence variation. Molecular phylogenetics and evolution 14(3):461-8
  18. Ref:11112280: Trievel RC, Li FY, Marmorstein R (2000) Application of a fluorescent histone acetyltransferase assay to probe the substrate specificity of the human p300/CBP-associated factor. Analytical biochemistry 287(2):319-28
  19. Ref:9396628: Fogel GB, Brunk CF (1997) Expression of Tetrahymena histone H4 in yeast. Biochimica et biophysica acta 1354(2):116-26
  20. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  21. Ref:1552842: Sadler LA, Brunk CF (1992) Phylogenetic relationships and unusual diversity in histone H4 proteins within the Tetrahymena pyriformis complex. Molecular biology and evolution 9(1):70-84
  22. Ref:1885002: Lin R, Cook RG, Allis CD (1991) Proteolytic removal of core histone amino termini and dephosphorylation of histone H1 correlate with the formation of condensed chromatin and transcriptional silencing during Tetrahymena macronuclear development. Genes & development 5(9):1601-10
  23. Ref:3360847: Richman R, Chicoine LG, Collini MP, Cook RG, Allis CD (1988) Micronuclei and the cytoplasm of growing Tetrahymena contain a histone acetylase activity which is highly specific for free histone H4. The Journal of cell biology 106(4):1017-26
  24. Ref:3822803: Horowitz S, Bowen JK, Bannon GA, Gorovsky MA (1987) Unusual features of transcribed and translated regions of the histone H4 gene family of Tetrahymena thermophila. Nucleic acids research 15(1):141-60

Sequences 

>TTHERM_00189170(coding)
ATGGCCGGTGGAAAAGGTGGTAAAGGTATGGGTAAGGTCGGAGCCAAGAGACACTCCAGA
AAGTCCAATAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAGA
AGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTATGATGACTCCAGACAAGTCTTGAAG
TCTTTCTTAGAAAACGTTGTTAGAGATGCTGTTACTTACACTGAACACGCCAGAAGAAAG
ACCGTCACTGCTATGGACGTCGTCTACGCTCTTAAGAGACAAGGCAGAACCCTCTATGGT
TTCGGTGGTTGA


>TTHERM_00189170(gene)
ATGGCCGGTGGAAAAGGTGGTAAAGGTATGGGTAAGGTCGGAGCCAAGAGACACTCCAGA
AAGTCCAATAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAGA
AGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTATGATGACTCCAGACAAGTCTTGAAG
TCTTTCTTAGAAAACGTTGTTAGAGATGCTGTTACTTACACTGAACACGCCAGAAGAAAG
ACCGTCACTGCTATGGACGTCGTCTACGCTCTTAAGAGACAAGGCAGAACCCTCTATGGT
TTCGGTGGTTGA


>TTHERM_00189170(protein)
MAGGKGGKGMGKVGAKRHSRKSNKASIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLK
SFLENVVRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG