Identifiers and Description

Gene Model Identifier

TTHERM_00189230

Standard Name

CYC14 (CYClin 14)

Aliases

PreTt08673 | 15.m00384 | 3697.m00096

Description

CYC14 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein; regulates activity of cyclin-dependent kinases

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06286.1 9.997093137033517e-262
Description: cyclin domain-containing protein (764 aa)
Oxytricha Contig12832.0.g49 3.000555717977434e-27
Description: Cyclin, N-terminal domain
DictyBase DDB_G0275493 2.999534586690157e-23
Description: cycB on chromosome: 2 position 6000211 to 6001649
SGD YDL155W 8.000721090200152e-18
Description: CLB3 B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the G2/M transition; may be involved in DNA replication and spindle assembly; accumulates during S phase and G2, then targeted for ubiquitin-mediated degradation
WormBase WBGene00000863 6.001122775063233e-17
Description: locus:cya-1 G2/mitotic-specific cyclin-A1 status:Confirmed UniProt:P34638 protein_id:CAA82372.1
Stentor Coeruleus SteCoe_28660 0.000000000013887943864964021
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00189230(coding)
ATGTCCATGATTGATGAAAATTCAAATACTATTCCTTTTTTTTAAAAGAGACATTCAATG
AAGAGCACCTATTGTAACTAAAATGACTTAATTTTTTAAAATAAAATGAATTATTCATAA
AGAATGCCTTTTGAAGAAGTTGTTTCGTTACAACCCTAATAAATAATTTACTCTTAAAAG
TCAGTAGCTTGTGAAGATTAGCAAAATATGAAGTAAAGTGTTAAATTTCCTGCTTAAGTT
GGCTAAAACTAATAACAGAGCAGCACTTTAAACAATTACTCAAACGACCTATCTCCTATA
GACATGACATTTTAGTAAATAAGCACTTAAAGTAGCTCTCCTGATTTCGATTTAGCAGTC
ATTAAAAATCCCTCCTCATCTTAAAACGTAAACATAAGCAATAAGTCTAGTTCTTTTGTT
GGGTCTGGGTCTATTAGCGGAATGAGCAGCTTTAAATAAATGAGTAACAACTAATAAAAA
AGCATGAATTAATCTTCATAATAATAAGCAATTGCCAAAGAATATAAAAATTACTCTTAA
AGTGGAAATAGCATGTAGGAGCTAAGTTCTGTTAGCACTAGAGTTAACAGCTATAGTACA
AATGCAAGCTCTGGATTAAATAAAAATAAATCTAGCAACTACACATTCTAAGAAGAGTAA
GATGAGAATTCATAAGTCTGCAGCAATATTTTAATAGATTAGATGGATTGCCAAGAGGTA
GAAGATTTCAGTCTTTATATCTAAGAGTATGAAAAGTAAAATGCAAACTCTAGCTAAGAA
CAATAGAGAAAATAGGCAATTTCCTAAGAAGATATTTATTAAGAGTAACTTTTTGGTGGT
AATCCTCAATACGTTCCTAAGTACGGCTACTAAATAGTCTAACACCTCTTCAAACAACAG
AGAAACTATAAAATAACTGTAATCACTGATCCTAGAGAATTAATTATTAGAGAAAATCTA
ATTGATTTAATGTCTCGTTTGCACACTCACCTTAAGTTGCAAGAAGAAACACTTTATCTT
GCTGTAAATATTTTCGCCAGATACTTAGACGTCTAAAAACAAAACTACTAAAACTAAAAA
ATTGTAACTCTAGTTGCAACTTGTCTCTTCATAGCTGCTAAATACTAAGAAATTTATCCT
CCTCCTCTTCGTGATTTTTTACATGTCCTTAAACTCAATAAAATCCAAGCTAATACTTCT
GATATATGTGATTTAGAAGGAAGCATTCTCAATAAATTAAACTTTTCTCTCTTCGGTCCT
ACTCGTTTACAATTCCTTGAAGCTTATTTCTCTTAAATTACTCTAGACCCATCTCAAGTC
AGCTTTTGCTATTATTTACTTGAACTAACAAACTTAAACCACTCCTTCTACAAATATGAC
CACAGTGAAATTGCTGCTGCATGCATACTTTTAAGTGAAAAATTCAAAAATATTTCTGGC
AAATATTTTTGGAGTGAAAAATTAGAACTAATTACAAACTATAAATAATAAGATGTTTAT
GACTGCGTTGAAGAGCTTTATTAGTACTTAGTTAATGTAGGACACAACAGGAAAAAATTA
TTTATTTACTCCAAATATTCTGAACAAAAATACAAATCTGTTGCTTTGATTGATTATGAC
CTCACTCACAATGTTAATAACTAAACCAACTAAGAAAGCACTTAAGATGGATTTTACATT
TCTACTTCTAATAATCAAAAAAGTGAGAATAACTACTCATAGTAATAAAAAATTTACACA
AATAAGTAAATGACACAATCCTAATAACTATCTTAGTCTTGCAATTAAGGCTATAACAGT
AGCATGACTTAATCAACCTATAACATGACTTATTCATAAAATAGTTAGAACTACGATTCA
TAACAGATACAAGAGTAACAATATTATTCTAAATAAATGTCTTAATAAAACAATTAAATT
GCTTACTCTAAATGCAAATCTGAATGCTATGCTGAGGAATATGACGAAAACTCTGTTAGC
TTTCATTCTTAAGCCAGATAAAATTAACCAAATTTCAAATATGACATTACAAAATACTCA
AAAATTTACTGA


>TTHERM_00189230(gene)
ATGTCCATGATTGATGAAAATTCAAATACTATTCCTTTTTTTTAAAAGAGACATTCAATG
AAGAGCACCTATTGTAACTAAAATGACTTAATTTTTTAAAATAAAATGAATTATTCATAA
AGAATGCCTTTTGAAGAAGTTGTTTCGTTACAACCCTAATAAATAATTTACTCTTAAAAG
TCAGTAGCTTGTGAAGATTAGCAAAATATGAAGTAAAGTGTTAAATTTCCTGCTTAAGTT
GGCTAAAACTAATAACAGAGCAGCACTTTAAACAATTACTCAAACGACCTATCTCCTATA
GACATGACATTTTAGTAAATAAGCACTTAAAGTAGCTCTCCTGATTTCGATTTAGCAGTC
ATTAAAAATCCCTCCTCATCTTAAAACGTAAACATAAGCAATAAGTCTAGTTCTTTTGTT
GGGTCTGGGTCTATTAGCGGAATGAGCAGCTTTAAATAAATGAGTAACAACTAATAAAAA
AGCATGAATTAATCTTCATAATAATAAGCAATTGCCAAAGAATATAAAAATTACTCTTAA
AGTGGAAATAGCATGTAGGAGCTAAGTTCTGTTAGCACTAGAGTTAACAGCTATAGTACA
AATGCAAGCTCTGGATTAAATAAAAATAAATCTAGCAACTACACATTCTAAGAAGAGTAA
GATGAGAATTCATAAGTCTGCAGCAATATTTTAATAGATTAGATGGATTGCCAAGAGGTA
GAAGATTTCAGTCTTTATATCTAAGAGTATGAAAAGTAAAATGCAAACTCTAGCTAAGAA
CAATAGAGAAAATAGGCAATTTCCTAAGAAGATATTTATTAAGAGTAACTTTTTGGTGGT
AATCCTCAATACGTTCCTAAGTACGGCTACTAAATAGTCTAACACCTCTTCAAACAACAG
GTAATTACTTATTAAATTATTTCTATCTATTGTTATTGAAAGTCCTAAAGATTTTCAAAG
ATTAAGGATAAAAATATTTCTAAAATAATAAGAATTTGAAATAGAAATAATCTTGCAAAA
ATGGCTTCAAAAAGCAATTTAAAATTGAGTTATTCAATATATTCCTTGTTCCGTTTTCAA
GTTTTTAAAGTAAATAAATGGAAAAATATGTGATAGATAAATTATGATTTTTATCCGCTA
TTTTTTTTTTAAATTATTTGATTAAAACCCATAGAAATAATTAATTTTCAACAAATTTTT
TGCCAAATTTTCTTAATTAAAACCAAAATAATATCAATCAAATAAATTAAAGAGTTAAAT
TATAACTTAAAGAAAATCTTTAAACTATCCTTTATTTACAATAAAAAAAATATTACTATA
ATTGATACCTAGATAGATAGGTACATGTTTTATTAAAATTTTGCATCATTATTTTTCTAA
TTTTTCTCAAGATTAAAATAAAAGAAAAATGAAAAATTTGAAATTCATTAAATTTTGCGC
TTAATTTTACTTTAAATTTATCTTGCATTTATTAATATTTTAATTTTAAAAATAAATAGA
GAAACTATAAAATAACTGTAATCACTGATCCTAGAGAATTAATTATTAGAGAAAATCTAA
TTGATTTAATGTCTCGTTTGCACACTCACCTTAAGTTGCAAGAAGAAACACTTTATCTTG
CTGTAAATATTTTCGCCAGATACTTAGACGTCTAAAAACAAAACTACTAAAACTAAAAAA
TTGTAACTCTAGTTGCAACTTGTCTCTTCATAGCTGCTAAATACTAAGAAATTTATCCTC
CTCCTCTTCGTGATTTTTTACATGTCCTTAAACTCAATAAAATCCAAGCTAATACTTCTG
ATATATGTGATTTAGAAGGAAGCATTCTCAATAAATTAAACTTTTCTCTCTTCGGTCCTA
CTCGTTTACAATTCCTTGAAGCTTATTTCTCTTAAATTACTCTAGACCCATCTCAAGTCA
GCTTTTGCTATTATTTACTTGAACTAACAAACTTAAACCACTCCTTCTACAAATATGACC
ACAGTGAAATTGCTGCTGCATGCATACTTTTAAGTGAAAAATTCAAAAATATTTCTGGCA
AATATTTTTGGAGTGAAAAATTAGAACTAATTACAAACTATAAATAATAAGATGTTTATG
ACTGCGTTGAAGAGCTTTATTAGTACTTAGTTAATGTAGGACACAACAGGAAAAAATTAT
TTATTTACTCCAAATATTCTGAACAAAAATACAAATCTGTTGCTTTGATTGATTATGACC
TCACTCACAATGTTAATAACTAAACCAACTAAGAAAGCACTTAAGATGGATTTTACATTT
CTACTTCTAATAATCAAAAAAGTGAGAATAACTACTCATAGTAATAAAAAATTTACACAA
ATAAGTAAATGACACAATCCTAATAACTATCTTAGTCTTGCAATTAAGGCTATAACAGTA
GCATGACTTAATCAACCTATAACATGACTTATTCATAAAATAGTTAGAACTACGATTCAT
AACAGATACAAGAGTAACAATATTATTCTAAATAAATGTCTTAATAAAACAATTAAATTG
CTTACTCTAAATGCAAATCTGAATGCTATGCTGAGGAATATGACGAAAACTCTGTTAGCT
TTCATTCTTAAGCCAGATAAAATTAACCAAATTTCAAATATGACATTACAAAATACTCAA
AAATTTACTGA


>TTHERM_00189230(protein)
MSMIDENSNTIPFFQKRHSMKSTYCNQNDLIFQNKMNYSQRMPFEEVVSLQPQQIIYSQK
SVACEDQQNMKQSVKFPAQVGQNQQQSSTLNNYSNDLSPIDMTFQQISTQSSSPDFDLAV
IKNPSSSQNVNISNKSSSFVGSGSISGMSSFKQMSNNQQKSMNQSSQQQAIAKEYKNYSQ
SGNSMQELSSVSTRVNSYSTNASSGLNKNKSSNYTFQEEQDENSQVCSNILIDQMDCQEV
EDFSLYIQEYEKQNANSSQEQQRKQAISQEDIYQEQLFGGNPQYVPKYGYQIVQHLFKQQ
RNYKITVITDPRELIIRENLIDLMSRLHTHLKLQEETLYLAVNIFARYLDVQKQNYQNQK
IVTLVATCLFIAAKYQEIYPPPLRDFLHVLKLNKIQANTSDICDLEGSILNKLNFSLFGP
TRLQFLEAYFSQITLDPSQVSFCYYLLELTNLNHSFYKYDHSEIAAACILLSEKFKNISG
KYFWSEKLELITNYKQQDVYDCVEELYQYLVNVGHNRKKLFIYSKYSEQKYKSVALIDYD
LTHNVNNQTNQESTQDGFYISTSNNQKSENNYSQQQKIYTNKQMTQSQQLSQSCNQGYNS
SMTQSTYNMTYSQNSQNYDSQQIQEQQYYSKQMSQQNNQIAYSKCKSECYAEEYDENSVS
FHSQARQNQPNFKYDITKYSKIY