Identifiers and Description

Gene Model Identifier

TTHERM_00191270

Standard Name

CTH54 (CaTHepsin 54)

Aliases

PreTt08778 | 15.m00489 | 3697.m00200

Description

CTH54 papain family cysteine protease; Cysteine proteinase 3 precursor, putative; Peptidase C1A

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• alpha6-beta1 integrin-CD151 complex (IEA) | GO:0071059
• creatine kinase complex (IEA) | GO:0002185
• external side of cell wall (IEA) | GO:0010339
• external side of plasma membrane (IEA) | GO:0009897
• macropinocytic cup (IEA) | GO:0070685
• metallochaperone complex (IEA) | GO:1902695
• mitochondrial ATP-gated potassium channel complex (IEA) | GO:0062157
• mitotic nuclear membrane microtubule tethering complex (IEA) | GO:0106084
• obsolete ectoplasm (IEA) | GO:0043265
• obsolete integral component of mitochondrial membrane (IEA) | GO:0032592
• obsolete intrinsic component of synaptic vesicle membrane (IEA) | GO:0098563
• superoxide dismutase copper chaperone complex (IEA) | GO:1902694
• THO complex (IEA) | GO:0000347

Molecular Function

• 11-deoxycorticosterone binding (IEA) | GO:1903878
• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
• ABC-type maltose transporter activity (IEA) | GO:0015423
• ABC-type oligosaccharide transporter activity (IEA) | GO:0015422
• Ac-Asp-Glu binding (IEA) | GO:1904492
• alternative oxidase activity (IEA) | GO:0009916
• amino acid transmembrane transporter activity (IEA) | GO:0015171
• amorpha-4,11-diene 12-monooxygenase activity (IEA) | GO:0062150
• aromatase activity (IEA) | GO:0008402
• arsenate reductase (glutaredoxin) activity (IEA) | GO:0008794
• axon guidance receptor activity (IEA) | GO:0008046
• C-X-C chemokine receptor activity (IEA) | GO:0016494
• carboxymethylenebutenolidase activity (IEA) | GO:0008806
• corticosterone binding (IEA) | GO:1903875
• Cys-tRNA(Pro) hydrolase activity (IEA) | GO:0043907
• cytoskeletal anchor activity (IEA) | GO:0008093
• delta5-delta2,4-dienoyl-CoA isomerase activity (IEA) | GO:0008416
• ferric triacetylfusarinine C:proton symporter activity (IEA) | GO:0015346
• histone succinyltransferase activity (IEA) | GO:0106078
• inositol bisphosphate phosphatase activity (IEA) | GO:0016312
• insulin-like growth factor II binding (IEA) | GO:0031995
• interleukin-10 receptor binding (IEA) | GO:0005141
• interleukin-12 receptor binding (IEA) | GO:0005143
• intracellularly cGMP-activated cation channel activity (IEA) | GO:0005223
• L-gulono-1,4-lactone dehydrogenase activity (IEA) | GO:0080049
• lipopolysaccharide heptosyltransferase activity (IEA) | GO:0008920
• lipopolysaccharide-1,6-galactosyltransferase activity (IEA) | GO:0008921
• mannose-1-phosphate guanylyltransferase (GDP) activity (IEA) | GO:0008928
• membrane insertase activity (IEA) | GO:0032977
• mercury ion transmembrane transporter activity (IEA) | GO:0015097
• mitotic anaphase-promoting complex inhibitor activity (IEA) | GO:0061637
• N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase activity (IEA) | GO:0008499
• N-acetyl-gamma-aminoadipyl-phosphate reductase activity (IEA) | GO:0043870
• N6-methyl-AMP deaminase activity (IEA) | GO:0062154
• obsolete cation:cation antiporter activity (IEA) | GO:0015491
• obsolete D-lysine oxidase activity (IEA) | GO:0043912
• obsolete exogenous peptide receptor activity (IEA) | GO:0008530
• obsolete peroxisome-assembly ATPase activity (IEA) | GO:0008573
• obsolete proprotein convertase 2 activator activity (IEA) | GO:0016484
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• obsolete zinc, cadmium uptake permease activity (IEA) | GO:0015340
• oxidized purine nucleobase lesion DNA N-glycosylase activity (IEA) | GO:0008534
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• purinergic nucleotide receptor activity (IEA) | GO:0001614
• pyrimidine nucleotide-sugar transmembrane transporter activity (IEA) | GO:0015165
• Ser(Gly)-tRNA(Ala) hydrolase activity (IEA) | GO:0043908
• sphingomyelin phosphodiesterase activity (IEA) | GO:0004767
• sterol 14-demethylase activity (IEA) | GO:0008398
• substance P receptor activity (IEA) | GO:0016496
• threonine-type peptidase activity (IEA) | GO:0070003
• tumor necrosis factor receptor binding (IEA) | GO:0005164
• zinc efflux active transmembrane transporter activity (IEA) | GO:0015341

Biological Process

• 3-keto-sphinganine metabolic process (IEA) | GO:0006666
• antifungal peptide biosynthetic process (IEA) | GO:0002783
• asymmetric protein localization (IEA) | GO:0008105
• auditory receptor cell fate commitment (IEA) | GO:0009912
• baroreceptor detection of decreased arterial stretch (IEA) | GO:0003024
• branch elongation involved in mammary gland duct branching (IEA) | GO:0060751
• cardiac endothelial cell differentiation (IEA) | GO:0003348
• CD8-positive, alpha-beta cytotoxic T cell differentiation (IEA) | GO:0002308
• cell budding (IEA) | GO:0007114
• cell migration in diencephalon (IEA) | GO:0061381
• cell wall modification involved in fruit ripening (IEA) | GO:0009829
• cellular component organization or biogenesis (IEA) | GO:0071840
• cellular membrane fusion (IEA) | GO:0006944
• central nervous system myelin formation (IEA) | GO:0032289
• chronic inflammatory response to antigenic stimulus (IEA) | GO:0002439
• coenzyme A biosynthetic process (IEA) | GO:0015937
• coenzyme A metabolic process (IEA) | GO:0015936
• cyclic threonylcarbamoyladenosine biosynthetic process (IEA) | GO:0061504
• cytoplasmic translational termination (IEA) | GO:0002184
• cytotoxic T cell pyroptotic cell death (IEA) | GO:1902483
• detection of hydrogen ion (IEA) | GO:0003030
• detection of pH by carotid body chemoreceptor signaling (IEA) | GO:0003037
• detection of tumor cell (IEA) | GO:0002355
• endomitotic cell cycle (IEA) | GO:0007113
• epithelial cell differentiation involved in prostate gland development (IEA) | GO:0060742
• epithelium development (IEA) | GO:0060429
• epithelium regeneration (IEA) | GO:1990399
• excitation of vasomotor center by carotid body chemoreceptor signaling (IEA) | GO:0003041
• extraembryonic membrane development (IEA) | GO:1903867
• Factor XII activation (IEA) | GO:0002542
• female courtship behavior (IEA) | GO:0008050
• ferrous iron transmembrane transport (IEA) | GO:1903874
• fucose metabolic process (IEA) | GO:0006004
• galactose to glucose-1-phosphate metabolic process (IEA) | GO:0061612
• gallbladder development (IEA) | GO:0061010
• gamma-tubulin complex assembly (IEA) | GO:1902481
• glycolytic process from glycerol (IEA) | GO:0061613
• glycolytic process through fructose-6-phosphate (IEA) | GO:0061615
• helper T cell chemotaxis (IEA) | GO:0035704
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• hepaticobiliary system development (IEA) | GO:0061008
• homogentisate metabolic process (IEA) | GO:1901999
• hormone transport (IEA) | GO:0009914
• icosanoid secretion (IEA) | GO:0032309
• immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
• inferior colliculus development (IEA) | GO:0061379
• interleukin-28A secretion (IEA) | GO:0072628
• intestinal phytosterol absorption (IEA) | GO:0060752
• laminaritriose transport (IEA) | GO:2001097
• lung connective tissue development (IEA) | GO:0060427
• macrophage derived foam cell differentiation (IEA) | GO:0010742
• maintenance of left sidedness (IEA) | GO:0061969
• maltoheptaose catabolic process (IEA) | GO:2001123
• mitochondrial membrane organization (IEA) | GO:0007006
• mitotic cytokinetic cell separation (IEA) | GO:1902409
• mucosal tolerance induction (IEA) | GO:0002427
• muscle contraction (IEA) | GO:0006936
• negative regulation by organism of defense-related MAP kinase-mediated signal transduction pathway in other organism involved in symbiotic interaction (IEA) | GO:0052275
• negative regulation by organism of programmed cell death in other organism involved in symbiotic interaction (IEA) | GO:0052490
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
• negative regulation of anterior head development (IEA) | GO:2000743
• negative regulation of antimicrobial peptide production (IEA) | GO:0002785
• negative regulation of cellular glucuronidation (IEA) | GO:2001030
• negative regulation of central B cell deletion (IEA) | GO:0002899
• negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
• negative regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001033
• negative regulation of epithelial cell-cell adhesion involved in epithelium migration (IEA) | GO:1903682
• negative regulation of intrinsic apoptotic signaling pathway (IEA) | GO:2001243
• negative regulation of L-glutamine biosynthetic process (IEA) | GO:0062133
• negative regulation of leukocyte cell-cell adhesion (IEA) | GO:1903038
• negative regulation of metanephric nephron tubule epithelial cell differentiation (IEA) | GO:0072308
• negative regulation of peripheral B cell deletion (IEA) | GO:0002909
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• negative regulation of phospholipid translocation (IEA) | GO:0061093
• negative regulation of postsynaptic membrane organization (IEA) | GO:1901627
• negative regulation of proline biosynthetic process (IEA) | GO:1902006
• negative regulation of protein localization to mitotic spindle pole body (IEA) | GO:1902543
• negative regulation of response to drug (IEA) | GO:2001024
• negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062026
• negative regulation of steroid hormone biosynthetic process (IEA) | GO:0090032
• neutral lipid metabolic process (IEA) | GO:0006638
• neutrophil mediated immunity (IEA) | GO:0002446
• nipple development (IEA) | GO:0060618
• obsolete activation of MAPKK activity (IEA) | GO:0000186
• obsolete CDP phosphorylation (IEA) | GO:0061508
• obsolete chemi-mechanical coupling (IEA) | GO:0006943
• obsolete induction by organism of defense-related symbiont reactive oxygen species production (IEA) | GO:0052401
• obsolete induction by virus of host cell-cell fusion (IEA) | GO:0006948
• obsolete modulation by host of symbiont adenylate cyclase activity (IEA) | GO:0075075
• obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
• obsolete negative regulation by organism of symbiont salicylic acid-mediated defense response (IEA) | GO:0052491
• obsolete negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway (IEA) | GO:2001268
• obsolete pathogen-associated molecular pattern dependent modulation by organism of innate immune response in other organism involved in symbiotic interaction (IEA) | GO:0052308
• obsolete positive regulation by host of defense-related symbiont MAP kinase-mediated signal transduction pathway (IEA) | GO:0052502
• obsolete positive regulation of hydrogen peroxide-induced cell death (IEA) | GO:1905206
• obsolete positive regulation of polynucleotide 3'-phosphatase activity (IEA) | GO:1901969
• obsolete regulation of 1-deoxy-D-xylulose-5-phosphate synthase activity (IEA) | GO:1902395
• obsolete regulation of cellular ketone metabolic process by regulation of transcription from RNA polymerase II promoter (IEA) | GO:0072364
• obsolete regulation of glucose-6-phosphatase activity (IEA) | GO:0032114
• obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
• obsolete reproduction (IEA) | GO:0000003
• obsolete S/G2 transition of mitotic cell cycle (IEA) | GO:0002198
• ommochrome biosynthetic process (IEA) | GO:0006727
• P granule disassembly (IEA) | GO:1903864
• parathion metabolic process (IEA) | GO:0018952
• phagocytosis (IEA) | GO:0006909
• phenanthrene catabolic process via trans-9(R),10(R)-dihydrodiolphenanthrene (IEA) | GO:0018956
• phosphorylation (IEA) | GO:0016310
• plant-type cell wall modification (IEA) | GO:0009827
• polyterpenoid metabolic process (IEA) | GO:0016111
• positive regulation by organism of apoptotic process in other organism involved in symbiotic interaction (IEA) | GO:0052501
• positive regulation by organism of phytoalexin production in other organism involved in symbiotic interaction (IEA) | GO:0052329
• positive regulation by organism of programmed cell death in other organism involved in symbiotic interaction (IEA) | GO:0052330
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of antimicrobial peptide biosynthetic process (IEA) | GO:0002807
• positive regulation of antimicrobial peptide secretion (IEA) | GO:0002796
• positive regulation of cap-independent translational initiation (IEA) | GO:1903679
• positive regulation of defense response to bacterium, incompatible interaction (IEA) | GO:1902479
• positive regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001034
• positive regulation of flavonoid biosynthetic process (IEA) | GO:0009963
• positive regulation of flower development (IEA) | GO:0009911
• positive regulation of macropinocytosis (IEA) | GO:1905303
• positive regulation of myofibroblast differentiation (IEA) | GO:1904762
• positive regulation of peroxisome proliferator activated receptor signaling pathway (IEA) | GO:0035360
• positive regulation of prostaglandin secretion (IEA) | GO:0032308
• positive regulation of protein autoubiquitination (IEA) | GO:1902499
• positive regulation of response to cytokinesis checkpoint signaling (IEA) | GO:1902148
• positive regulation of response to water deprivation (IEA) | GO:1902584
• positive regulation of skeletal muscle satellite cell differentiation (IEA) | GO:1902726
• positive regulation of stress response to copper ion (IEA) | GO:1903855
• positive regulation of wound healing, spreading of epidermal cells (IEA) | GO:1903691
• priming of cellular response to stress (IEA) | GO:0080136
• primitive palate development (IEA) | GO:0062010
• pronephric glomerulus morphogenesis (IEA) | GO:0035775
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• prostate induction (IEA) | GO:0060514
• protein localization to mitotic spindle (IEA) | GO:1902480
• protein localization to old growing cell tip (IEA) | GO:1903858
• protein processing (IEA) | GO:0016485
• pteridine biosynthetic process (IEA) | GO:0006728
• pyoverdine biosynthetic process (IEA) | GO:0002049
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of antibacterial peptide biosynthetic process (IEA) | GO:0002808
• regulation of beta-glucan metabolic process (IEA) | GO:0032950
• regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria (IEA) | GO:0002816
• regulation of cardioblast proliferation (IEA) | GO:0003264
• regulation of cardiocyte differentiation (IEA) | GO:1905207
• regulation of cellular glucuronidation (IEA) | GO:2001029
• regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of double fertilization forming a zygote and endosperm (IEA) | GO:0080155
• regulation of glycoprotein metabolic process (IEA) | GO:1903018
• regulation of hematopoietic progenitor cell differentiation (IEA) | GO:1901532
• regulation of interferon-gamma secretion (IEA) | GO:1902713
• regulation of L-arginine import into cell (IEA) | GO:1902826
• regulation of macrophage derived foam cell differentiation (IEA) | GO:0010743
• regulation of microglial cell migration (IEA) | GO:1904139
• regulation of mitophagy (IEA) | GO:1901524
• regulation of pentose-phosphate shunt (IEA) | GO:0043456
• regulation of PERK-mediated unfolded protein response (IEA) | GO:1903897
• regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001245
• regulation of ripoptosome assembly involved in necroptotic process (IEA) | GO:1902442
• regulation of sprouting angiogenesis (IEA) | GO:1903670
• regulation of systemic arterial blood pressure by baroreceptor feedback (IEA) | GO:0003025
• regulation of systemic arterial blood pressure by carotid body chemoreceptor signaling (IEA) | GO:0003027
• regulation of turning behavior involved in mating (IEA) | GO:0061094
• regulation of wound healing, spreading of epidermal cells (IEA) | GO:1903689
• regulatory T cell apoptotic process (IEA) | GO:1902482
• relaxation of vascular associated smooth muscle (IEA) | GO:0060087
• release of sequestered calcium ion into cytosol by endoplasmic reticulum (IEA) | GO:1903514
• response to ethylene (IEA) | GO:0009723
• response to methamphetamine hydrochloride (IEA) | GO:1904313
• serotonin secretion involved in inflammatory response (IEA) | GO:0002442
• single-organism intercellular transport (IEA) | GO:1902585
• sperm aster formation (IEA) | GO:0035044
• striated muscle contraction (IEA) | GO:0006941
• synaptic vesicle docking (IEA) | GO:0016081
• T-helper 1 cell lineage commitment (IEA) | GO:0002296
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• tetrasaccharide transport (IEA) | GO:2001098
• tetraterpenoid biosynthetic process (IEA) | GO:0016109
• triterpenoid catabolic process (IEA) | GO:0016105
• vacuolar acidification (IEA) | GO:0007035
• vitamin A metabolic process (IEA) | GO:0006776
• xanthophyll biosynthetic process (IEA) | GO:0016123
• xanthophyll catabolic process (IEA) | GO:0016124

Domains

• ( PF00112 ) Papain family cysteine protease
• ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191270(coding)
ATGAAACAATCAATCATAATTGTTGCTTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGA
AACCATACCTTTGAAAGAGAAGTTTCTCATGGCAGACACAACGCCACTGAGTAAGAACTT
TTGAATATCTTTTCCTCTTATGGATATGTTGCTAATCCTTCCAGTGAGAGATTTAAAATC
TTTAAACAAAGATTAATTGATATCATCAAGCATAACCTCAATCCTCATAAGACTTACACT
TAAAAAATCAACAAATTCTCATTCTACACTCAGGAAGAGTTATCTGTGTTAAACGCTGCT
TAGAATTGCTCAGCCACTGCCAAAGAAAACATGGCCCCTAAAAAGAAATACAATCTTAAG
GACATTCCTGAATTTGTTGATTGGAGAACTAAGGGTATTGTTACTCCTGTTAAGAATCAA
GGCTAATGTGGTTCTTGTTGGACTTTCTCTACTACTGGTGCTCTTGAATCCCACTGGGCT
TTACACACCGGTAATGCTCCTTTATTACTCTCTGAATAATAATTGATTGACTGTGCAGGA
GACTTCAATAACTTTGGATGCAGTGGTGGTTTACCATCTCAAGCTTTTGAATATATTTCC
TATGCTGGTGGACTTGACACTGAAGGTGATTATCCTTATGAAGCTACAGATAATGAATGC
GAATTCAAACGTAGTCATGCTGCTGCTAAAGTTGTAAGATCCTTTAATATTACTTTCTAA
GATGAAGATGAATTGATTTATCACTTAGCTACTGCTGGCCCAATTTCTATTGCTTATCAA
GTTACTGATGACTTCTTTAAATACGATGGTGGTATTTACTCAAACCCTTACTGCTCTACT
TCTCCTGATATGGTTAATCATGCTGTCTTAGCTGTTGGTTACAACTTGACTGGACGTTAT
TATATAGTTAAGAACAGTTGGGGTGAGCATTGGGGTAATGAAGGTTACTTCAATATCGAA
TTAGGTTCAAACATGTGTGGTTTAGCTGATTGTGCCAGTTACCCTATTGTTTAAGGACAT
CACTAATATTGA

>TTHERM_00191270(gene)
ATCCATAGCTTATTTAAAAAAAATTGACTAATTAATTTATTAAAGAATTTTTATAAGTAA
CTCATAAAAAAGAAGAAAAAGATTGTGAATTAAAATGAAACAATCAATCATAATTGTTGC
TTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGAAACCATACCTTTGAAAGAGAAGTTTC
TCATGGCAGACACAACGCCACTGAGTAAGAACTTTTGAATATCTTTTCCTCTTATGGATA
TGTTGCTAATCCTTCCAGTGAGAGATTTAAAATCTTTAAACAAAGATTAATTGATATCAT
CAAGCATAACCTCAATCCTCATAAGACTTACACTTAAAAAATCAACAAATTCTCATTCTA
CACTCAGGAAGAGTTATCTGTGTTAAACGCTGCTTAGAATTGCTCAGCCACTGCCAAAGA
AAACATGGCCCCTAAAAAGAAATACAATCTTAAGGACATTCCTGAATTTGTTGATTGGAG
AACTAAGGGTATTGTTACTCCTGTTAAGAATCAAGGCTAATGTGGTTCTTGTTGGACTTT
CTCTACTACTGGTGCTCTTGAATCCCACTGGGCTTTACACACCGGTAATGCTCCTTTATT
ACTCTCTGAATAATAATTGATTGACTGTGCAGGAGACTTCAATAACTTTGGATGCAGTGG
TGGTTTACCATCTCAAGCTTTTGAATATATTTCCTATGCTGGTGGACTTGACACTGAAGG
TGATTATCCTTATGAAGCTACAGATAATGAATGCGAATTCAAACGTAGTCATGCTGCTGC
TAAAGTTGTAAGATCCTTTAATATTACTTTCTAAGATGAAGATGAATTGATTTATCACTT
AGCTACTGCTGGCCCAATTTCTATTGCTTATCAAGTTACTGATGACTTCTTTAAATACGA
TGGTGGTATTTACTCAAACCCTTACTGCTCTACTTCTCCTGATATGGTTAATCATGCTGT
CTTAGCTGTTGGTTACAACTTGACTGGACGTTATTATATAGTTAAGAACAGTTGGGGTGA
GCATTGGGGTAATGAAGGTTACTTCAATATCGAATTAGGTTCAAACATGTGTGGTTTAGC
TGATTGTGCCAGTTACCCTATTGTTTAAGGACATCACTAATATTGAAATTATTTATAAAA
TATTAAAAATTTTCATAAGTATTTTGCAATGTATAATGCTTTAGAAAATATAATAAGAAT
TTTAGATTTCATAAACCTAAAACCAATAATATCAAATAAAAAAATAAATAAATATATTAA
ATGCATTTATAAATACTTTTTTATCGTAGTAAATTTTAAATTTTAAGAAATTACCAATT

>TTHERM_00191270(protein)
MKQSIIIVALALLAIGVIARNHTFEREVSHGRHNATEQELLNIFSSYGYVANPSSERFKI
FKQRLIDIIKHNLNPHKTYTQKINKFSFYTQEELSVLNAAQNCSATAKENMAPKKKYNLK
DIPEFVDWRTKGIVTPVKNQGQCGSCWTFSTTGALESHWALHTGNAPLLLSEQQLIDCAG
DFNNFGCSGGLPSQAFEYISYAGGLDTEGDYPYEATDNECEFKRSHAAAKVVRSFNITFQ
DEDELIYHLATAGPISIAYQVTDDFFKYDGGIYSNPYCSTSPDMVNHAVLAVGYNLTGRY
YIVKNSWGEHWGNEGYFNIELGSNMCGLADCASYPIVQGHHQY