Identifiers and Description

Gene Model Identifier

TTHERM_00191270

Standard Name

CTH54 (CaTHepsin 54)

Aliases

PreTt08778 | 15.m00489 | 3697.m00200

Description

CTH54 papain family cysteine protease; Cysteine proteinase 3 precursor- putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06182.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (345 aa)
Oxytricha Contig13288.0.g37 6.002330506118426e-84
Description: Papain family cysteine protease
WormBase WBGene00000776 3.999543040313994e-55
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
DictyBase DDB_G0279799 1.0000099287337047e-53
Description: cprB on chromosome: 3 position 2569081 to 2570624
Stentor Coeruleus SteCoe_29480 1.2479464629129513e-47
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191270(coding)
ATGAAACAATCAATCATAATTGTTGCTTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGA
AACCATACCTTTGAAAGAGAAGTTTCTCATGGCAGACACAACGCCACTGAGTAAGAACTT
TTGAATATCTTTTCCTCTTATGGATATGTTGCTAATCCTTCCAGTGAGAGATTTAAAATC
TTTAAACAAAGATTAATTGATATCATCAAGCATAACCTCAATCCTCATAAGACTTACACT
TAAAAAATCAACAAATTCTCATTCTACACTCAGGAAGAGTTATCTGTGTTAAACGCTGCT
TAGAATTGCTCAGCCACTGCCAAAGAAAACATGGCCCCTAAAAAGAAATACAATCTTAAG
GACATTCCTGAATTTGTTGATTGGAGAACTAAGGGTATTGTTACTCCTGTTAAGAATCAA
GGCTAATGTGGTTCTTGTTGGACTTTCTCTACTACTGGTGCTCTTGAATCCCACTGGGCT
TTACACACCGGTAATGCTCCTTTATTACTCTCTGAATAATAATTGATTGACTGTGCAGGA
GACTTCAATAACTTTGGATGCAGTGGTGGTTTACCATCTCAAGCTTTTGAATATATTTCC
TATGCTGGTGGACTTGACACTGAAGGTGATTATCCTTATGAAGCTACAGATAATGAATGC
GAATTCAAACGTAGTCATGCTGCTGCTAAAGTTGTAAGATCCTTTAATATTACTTTCTAA
GATGAAGATGAATTGATTTATCACTTAGCTACTGCTGGCCCAATTTCTATTGCTTATCAA
GTTACTGATGACTTCTTTAAATACGATGGTGGTATTTACTCAAACCCTTACTGCTCTACT
TCTCCTGATATGGTTAATCATGCTGTCTTAGCTGTTGGTTACAACTTGACTGGACGTTAT
TATATAGTTAAGAACAGTTGGGGTGAGCATTGGGGTAATGAAGGTTACTTCAATATCGAA
TTAGGTTCAAACATGTGTGGTTTAGCTGATTGTGCCAGTTACCCTATTGTTTAAGGACAT
CACTAATATTGA


>TTHERM_00191270(gene)
ATGAAACAATCAATCATAATTGTTGCTTTGGCTCTTTTGGCAATTGGTGTTATTGCTAGA
AACCATACCTTTGAAAGAGAAGTTTCTCATGGCAGACACAACGCCACTGAGTAAGAACTT
TTGAATATCTTTTCCTCTTATGGATATGTTGCTAATCCTTCCAGTGAGAGATTTAAAATC
TTTAAACAAAGATTAATTGATATCATCAAGCATAACCTCAATCCTCATAAGACTTACACT
TAAAAAATCAACAAATTCTCATTCTACACTCAGGAAGAGTTATCTGTGTTAAACGCTGCT
TAGAATTGCTCAGCCACTGCCAAAGAAAACATGGCCCCTAAAAAGAAATACAATCTTAAG
GACATTCCTGAATTTGTTGATTGGAGAACTAAGGGTATTGTTACTCCTGTTAAGAATCAA
GGCTGTAAATATTTTATTTGATTGAATTCATATAATTTTTATCAAATCTTTTGCATTATT
AAAATCTATTTTAAAAGTCTTAAAAATAAATAATTCTACAATAAATTTCTTAATTATATA
TTAGAATGTGGTTCTTGTTGGACTTTCTCTACTACTGGTGCTCTTGAATCCCACTGGGCT
TTACACACCGGTAATGCTCCTTTATTACTCTCTGAATAATAATTGATTGACTGTGCAGGA
GACTTCAATAACTTTGGATGCAGTGGTGGTTTACCATCTCAAGCTTTTGAATATATTTCC
TATGCTGGTGGACTTGACAGTATTTCATATTTACAATTCTTTTTAGATAAATATATTGGA
AATTTTAAAAAGCTGATATGAAAACGATATTCGATTAATATTTATCATTTTAAAATATCT
AAAAAATGGATTGAACTTTCAAATTTGTTAATGAACAAGGCATACATATCTATCTTTATT
TCCTAATTCTTTTATAATTATAATATAATTACCACTCCAATTTGACAAACAAAACATAAT
AAACAATTTAAAGATATTGAATAGAAAACAGTATTTGTTTAAATAGACATATTTTTAGAT
AAATTATAAAATTAATTTTATTAGATCATTATTTATGTTATATTTTAAGAATTTTTAATT
ATATTTTAACAGCTGAAGGTGATTATCCTTATGAAGCTACAGATAATGAATGCGAATTCA
AACGTAGTCATGCTGCTGCTAAAGTTGTAAGATCCTTTAATATTACTTTCTAAGATGAAG
ATGAATTGATTTATCACTTAGCTACTGCTGGCCCAATTTCTATTGCTTATCAAGTTACTG
ATGACTTCTTTAAATACGATGGTGGTATTTACTCAAACCCTTACTGCTCTACTTCTCCTG
ATATGGTTAATCATGCTGTCTTAGCTGTTGGTTACAACTTGACTGGACGTTATTATATAG
TTAAGAACAGTTGGGGTGAGCATTGGGGTAATGAAGGTTACTTCAATATCGAATTAGGTT
CAAACATGTGTGGTTTAGCTGATTGTGCCAGTTACCCTATTGTTTAAGGACATCACTAAT
ATTGA


>TTHERM_00191270(protein)
MKQSIIIVALALLAIGVIARNHTFEREVSHGRHNATEQELLNIFSSYGYVANPSSERFKI
FKQRLIDIIKHNLNPHKTYTQKINKFSFYTQEELSVLNAAQNCSATAKENMAPKKKYNLK
DIPEFVDWRTKGIVTPVKNQGQCGSCWTFSTTGALESHWALHTGNAPLLLSEQQLIDCAG
DFNNFGCSGGLPSQAFEYISYAGGLDTEGDYPYEATDNECEFKRSHAAAKVVRSFNITFQ
DEDELIYHLATAGPISIAYQVTDDFFKYDGGIYSNPYCSTSPDMVNHAVLAVGYNLTGRY
YIVKNSWGEHWGNEGYFNIELGSNMCGLADCASYPIVQGHHQY