Identifiers and Description

Gene Model Identifier

TTHERM_00191280

Standard Name

CTH48 (CaTHepsin 48)

Aliases

PreTt08779 | 15.m00490 | 3697.m00201

Description

CTH48 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06182.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (345 aa)
Oxytricha Contig13288.0.g37 6.997046864049712e-88
Description: Papain family cysteine protease
DictyBase DDB_G0283867 6.002077021906841e-60
Description: cprC on chromosome: 4 position 1092858 to 1094270
WormBase WBGene00000776 9.001131581050935e-57
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_29480 1.2479464629129513e-47
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00191280(coding)
ATGAGATAAACAATATTAATTGCAGTTTTAGTCTTATGCGCTGCAAGCGTTATTGCTAGA
AATGTTACTTTTGAGTAAGAAGTTGCTCATGGTAGACATAACCCCACTGAAGCTGAACTT
TTGAAGATCTTTGCTTCTTTTGGCTTCCACCCTAATCCCTTAAGTGATAGATTCAGACTC
TTCAAGAAGAGATTAACTAATATTATTAAGCATAACTTAAATCCCCATAAGAAGTTCACT
TAAAAGATCAACAAGTTCACTTTCAAGACCTAAGAAGAAATCAGAAGCTTAAATGCTGCT
CAAAACTGCTCTGCTACTGCCAGAGAAAATATGTCAGTTAAAAAGACCTACAACCTCAAG
GATCTTCCTTAATACGTTGACTGGAGAACTAAGGGTGTTGTTACTCCTGTTAAGGATCAA
GGAGAATGTGGTTCTTGCTGGACTTTCTCTACTACCGGTGCTCTTGAATCCCACTGGGCT
TTACACACTGGTAATGCTCCCTTATTGCTTTCTGAATAATAATTGATTGATTGTGCTGGC
GCTTTCAACAATTTCGGTTGCGATGGTGGTTTACCCTCCTAAGCTTATGAATATATTTCC
TATGCTGGTGGTCTTGAAACTGAAGGTGACTATCCTTATGAAGGTACTGACAACTCTTGT
GAATTCAACCGTGCTTAAGTTGCTGCTAAGGTAGTTTCTTCATACAACATTACCTTCTAA
GATGAAAATGAATTGATCTACCACTTAGCCACAGTTGGTCCAGTTTCTATTGCTTATGAA
TGTACTGATGATTTCATGGATTACGAAGGTGGTATTTACTCTAACCCTTCTTGCTCAAAA
TCCCCTGAAGATGTTAACCACGCTGTTTTAGCTGTAGGATATAACTTAACTGGTAACTAC
TACATTGTTAAAAATAGTTGGGGTGAAGACTGGGGTATCAACGGTTATTTCTATATTGAA
TTAGGCTCAAATATGTGTGGTTTAGCTGATTGTGCTAGTTACCCTATTGTCCATACTCAC
CATGAATAGTGA


>TTHERM_00191280(gene)
ATGAGATAAACAATATTAATTGCAGTTTTAGTCTTATGCGCTGCAAGCGTTATTGCTAGA
AATGTTACTTTTGAGTAAGAAGTTGCTCATGGTAGACATAACCCCACTGAAGCTGAACTT
TTGAAGATCTTTGCTTCTTTTGGCTTCCACCCTAATCCCTTAAGTGATAGATTCAGACTC
TTCAAGAAGAGATTAACTAATATTATTAAGCATAACTTAAATCCCCATAAGAAGTTCACT
TAAAAGATCAACAAGTTCACTTTCAAGACCTAAGAAGAAATCAGAAGCTTAAATGCTGCT
CAAAACTGCTCTGCTACTGCCAGAGAAAATATGTCAGTTAAAAAGACCTACAACCTCAAG
GATCTTCCTTAATACGTTGACTGGAGAACTAAGGGTGTTGTTACTCCTGTTAAGGATCAA
GGAGGTATAAAAGATTTTTGTTTTACTTATAGAGACTTCTTAAAATATTGGATTAAAATT
TAGTTAAAAACATGATTTAGCAAAAATATAATAGTTTTAACCTTTATTTAACAAGCCATT
TAAATATTATTATTAAAAATTAGAATGTGGTTCTTGCTGGACTTTCTCTACTACCGGTGC
TCTTGAATCCCACTGGGCTTTACACACTGGTAATGCTCCCTTATTGCTTTCTGAATAATA
ATTGATTGATTGTGCTGGCGCTTTCAACAATTTCGGTTGCGATGGTGGTTTACCCTCCTA
AGCTTATGAATATATTTCCTATGCTGGTGGTCTTGAAAGTAAATAAAATTTAAATTTAGT
TTGGTTAGCTAACGCATAAATTGAAGAGAAAAAAAAATGTTAATAAGAGCATTAAATAAA
TAAATAAATATTTAGTGTTTTGGCTTAACCCTCCCTTGAGCTGTTTAGAAATATTTGATT
AACCCAAAGCTTAATAGATAAAAAACCTCTATTAAAATTAGGCGATTTATTGGTGCATAT
CTTAAAAGATGAATTACTAAATTCTTTTATAATTTTAATATTTCTTACGAAATAATCAAT
CCAACTTTAAGATTTTTTCTCTCATTAAATATTTTGATTGAAAACAGCCATAAAGCAGAA
TACACTCAAAGCAATTTATTTTTCTCAAGCATAAAATAATTTATCTAAAATATTTTCAAA
ATATATTGTTTAACGAAAAATCTAATCAATTTTTTCTTAAAAATAGCTGAAGGTGACTAT
CCTTATGAAGGTACTGACAACTCTTGTGAATTCAACCGTGCTTAAGTTGCTGCTAAGGTA
GTTTCTTCATACAACATTACCTTCTAAGATGAAAATGAATTGATCTACCACTTAGCCACA
GTTGGTCCAGTTTCTATTGCTTATGAATGTACTGATGATTTCATGGATTACGAAGGTGGT
ATTTACTCTAACCCTTCTTGCTCAAAATCCCCTGAAGATGTTAACCACGCTGTTTTAGCT
GTAGGATATAACTTAACTGGTAACTACTACATTGTTAAAAATAGTTGGGGTGAAGACTGG
GGTATCAACGGTTATTTCTATATTGAATTAGGCTCAAATATGTGTGGTTTAGCTGATTGT
GCTAGTTACCCTATTGTCCATACTCACCATGAATAGTGA


>TTHERM_00191280(protein)
MRQTILIAVLVLCAASVIARNVTFEQEVAHGRHNPTEAELLKIFASFGFHPNPLSDRFRL
FKKRLTNIIKHNLNPHKKFTQKINKFTFKTQEEIRSLNAAQNCSATARENMSVKKTYNLK
DLPQYVDWRTKGVVTPVKDQGECGSCWTFSTTGALESHWALHTGNAPLLLSEQQLIDCAG
AFNNFGCDGGLPSQAYEYISYAGGLETEGDYPYEGTDNSCEFNRAQVAAKVVSSYNITFQ
DENELIYHLATVGPVSIAYECTDDFMDYEGGIYSNPSCSKSPEDVNHAVLAVGYNLTGNY
YIVKNSWGEDWGINGYFYIELGSNMCGLADCASYPIVHTHHEQ