Identifiers and Description

Gene Model Identifier

TTHERM_00191490

Standard Name

ASI1 (Anlagen Stage Induced 1 )

Aliases

PreTt08800 | 15.m00511 | 3697.m00222

Description

ASI1 anlagen stage induced 1 protein; Zinc-finger protein of unknown function; developmentally regulated transcript induced during macronuclear anlagen stage; encodes a 95 kDa conceptual protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06167.1 9.997093137033517e-262
Description: anlagen stage induced 1 protein (808 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12351190: Udani RA, Karrer KM (2002) ASI1, a gene encoding a novel leucine zipper protein, is induced during development of the macronucleus in Tetrahymena. Mechanisms of development 118(1-2):215-8

Sequences

>TTHERM_00191490(coding)
ATGCAAGATACCTTAGATGCTAAAAACAGCTATCTTAATTTTACTTTCTCTGAATCCAGG
ATTAAAGGAATTTCAAATATAAAAAATGCTAATCTGCTTAAAAATAATTAAGCTACAAGT
ATTATGGAATTAGATCAAACACTTCAAGCATTCCATAAAGCGTCACATGGTAATTTGAAG
AATATAATCAAGAATGCTGAAATATGCGCATTAGATCAATATAGTATCCAAAACAGATAA
TAAAATTTTGAAACTATAACATTAAATAAAAACAAATCTTAAAGTAGAGTTAGCAAAACT
GAAATTAGGAGTCTAAATCCACTTTCATGCAATGAATCTGAGAAAACAAAGTACTTTGAA
AATGAATAGGATAATTTATGTAATTTAGAAGATGAATACGAAAATGAGAGTAATTATCAT
AAAAATAATTTAGAGTCATAGTAAAGTAGCACACAGCTATTTGCAAATATTAGGCAAACT
AAGATATTTTAATAAATGAGAGACTATGTACGAACTCTAAAGAAGAATAAAATTATCTAA
AAATTTTGGTTTTGTTAAATAAATAGCAGATGGACTCGATAAAAGTAGCTTAATGTTTCA
TTCTTAATGATGAGTATTTGTATAATTAGTATTTTATTGATTTGCTGGGTTCTACTTTTA
TTCTTTATGTATCGTATTTTTGATGACACTTACTATCCAAATTACTCTGAAAGTGAAAAA
AATTAACTAATTTATACCTTATCCTCTTTACAAGAATCATTAGTTAGTCTCTTAAGAAGA
ACTGACCATCTTCACCAAGTCGCCATTAGCATTTATTAATCACAATAAAAAGGTCCCAAA
AACCCTTTTTACGATATTAATTTTGATTCTCATATATTAAAAGGAAAACAAAATTACATT
TCAATAAACTAAGATGTGTCACCTCAATTTAATGATACTTTAGGCTTTTACTTTTAAAAT
GTTGATACTCCAATTACATATGATTTTTTTTAATGGGCTACGTTTATAGACCAAAGAAAT
TACACTCATATTACACCAGAATCTTAGAAGATTCTTGATGACTTTGATATACTTAGTTAT
TTCATAAAAAACTTAATTGCTAATGCAAAATTTTCATTTTCTTACTCTTATTATTGTGGA
TTTGAAACAGATGAATTAGTTGTCTATTATCCAGCTGGTTTATAAAATGCTCTCAGAGGG
AAAGACAAGGTACCTGATTTTAGTTTTCACCCAAATTAGAGGGATTGGTACTCCTAAATA
ATTAAAAATAACCTATAGTATACAAATCAAACTTACTTTACTCTCCCCTATAAAGATTAA
ATAACTTAGCAATATATAATGACCATGTCTGTTGCTCTTCGTGATTAGGATGGAAAATTT
TAAGGTGTTTGTGCTACTGACTATTACTTAGATAAATTTGACAAATATATAAATTCAATA
GGCATAAATGAGTATTCTATTATGGCTCTGATAGATGCCAGTAACGATAATGGTATTATT
CTAACATAAAACAGTAGTATTATTAACTTTACTCCATAACAGTTCTTACAATTTTCTCCC
TCTTAATGGACAGATATGAAATAGCAAATACTTTAAACATTTAACAATAATACTAACAGC
TTAAATTCTTATAGCTATTTTTAAGACATTTAAGGATTTAAAGTTGCTGGTTCTGCTTTT
AAATCCAAAAATTCAAATGATCAAACCTTTATTTTATTAGTGAAGGAATCTACAAATTAG
TTCGAAAGACTTTACGATACAATAATTTAAAGAGTTTAAGATAAATATATTAAACCGAAT
ATTAACTTTATAATCGCATTTCTAGTGATAAGCTTTGCTCACATTATTTATTGCTTAATA
ATGAGTTATTATGTTACTCAACCTTATAGAAAAATAAAGTAGATATCTAACTAAATTACA
TAGAATTTAAAGGCATCAAATTAAATAGGATCACTTGATTCATACTTAAACACTTTAGAT
TTTAAAAGTGATAGAAATTTATATATTCTAGTCAAGTCTGCAAAAAAAATGGTTTTAAAA
ATATAAAAAGCCAGTACTAAGAAAATAATCGAAAATTAAAAATATTATCATGCTTATCAT
TATGAGTAAAATGAGTATTTTGATAGTCAAATGGAGTGGAGAGATGAAATAGAACAGCTG
GTAGATTATGGATTATCAAAAAACTTTAATTCACTCCCTACAAACCTAGAATTCTTCAAC
GATTGTGAATCAAAAATCACTGAGCTCAGAGATAACTCTCCCTTTGCTATTGTCAACAAT
AAATAAGAATCGCTAAAAATTAAATAAAAAATACTATCTGAAGATTCATTTTGCAAATCT
GTCTCTGTTCCATACATTGACTAAAAGTTCATGAACCACATCGAACAATATCTTCCCAAT
TTCTAAATGCCCTGA


>TTHERM_00191490(gene)
ATGCAAGATACCTTAGATGCTAAAAACAGCTATCTTAATTTTACTTTCTCTGAATCCAGG
ATTAAAGGAATTTCAAATATAAAAAATGCTAATCTGCTTAAAAATAATTAAGCTACAAGT
ATTATGGAATTAGATCAAACACTTCAAGCATTCCATAAAGCGTCACATGGTAATTTGAAG
AATATAATCAAGAATGCTGAAATATGCGCATTAGATCAATATAGTATCCAAAACAGATAA
TAAAATTTTGAAACTATAACATTAAATAAAAACAAATCTTAAAGTAGAGTTAGCAAAACT
GAAATTAGGAGTCTAAATCCACTTTCATGCAATGAATCTGAGAAAACAAAGTACTTTGAA
AATGAATAGGATAATTTATGTAATTTAGAAGATGAATACGAAAATGAGAGTAATTATCAT
AAAAATAATTTAGAGTCATAGTAAAGTAGCACACAGCTATTTGCAAATATTAGGCAAACT
AAGATATTTTAATAAATGAGAGACTATGTACGAACTCTAAAGAAGAATAAAATTATCTAA
AAATTTTGGTTTTGTTAAATAAATAGCAGATGGACTCGATAAAAGTAGCTTAATGTTTCA
TTCTTAATGATGAGTATTTGTATAATTAGTATTTTATTGATTTGCTGGGTTCTACTTTTA
TTCTTTATGTATCGTATTTTTGATGACACTTACTATCCAAATTACTCTGAAAGTGAAAAA
AATTAACTAATTTATACCTTATCCTCTTTACAAGAATCATTAGTTAGTCTCTTAAGAAGA
ACTGACCATCTTCACCAAGTCGCCATTAGCATTTATTAATCACAATAAAAAGGTCCCAAA
AACCCTTTTTACGATATTAATTTTGATTCTCATATATTAAAAGGAAAACAAAATTACATT
TCAATAAACTAAGATGTGTCACCTCAATTTAATGATACTTTAGGCTTTTACTTTTAAAAT
GTTGATACTCCAATTACATATGATTTTTTTTAATGGGCTACGTTTATAGACCAAAGAAAT
TACACTCATATTACACCAGAATCTTAGAAGATTCTTGATGACTTTGATATACTTAGTTAT
TTCATAAAAAACTTAATTGCTAATGCAAAATTTTCATTTTCTTACTCTTATTATTGTGGA
TTTGAAACAGATGAATTAGTTGTCTATTATCCAGCTGGTTTATAAAATGCTCTCAGAGGG
AAAGACAAGGTACCTGATTTTAGTTTTCACCCAAATTAGAGGGATTGGTACTCCTAAATA
ATTAAAAATAACCTATAGTATACAAATCAAACTTACTTTACTCTCCCCTATAAAGATTAA
ATAACTTAGCAATATATAATGACCATGTCTGTTGCTCTTCGTGATTAGGTAAAAGATCTA
TTTAATATTTTTTTATTTTTTGTCAATATTTTTTTGTAAAAAGATATTTCACCTGAATCA
GGTTAAAAAACCTTCTAATAAATATCCTGCAGAAACAATAAATTTAATTATTAAATCAAA
TTCTAAATTCTGAATTGATTTTTCTATCAATCAGAATCAAAAATTATTTATTACCAAATT
TCAAAACAAAAATAATAAATTAATTAATTTACTAGTGTAACATTGAACAATAAGTTATTT
ATTTATTTATTGATTTAATGAATGATAAAAAACAAAATATTCTTAAGCTTTTCCCTTAAG
ACAATTATTATTTAATTTTAAAAAGGATGGAAAATTTTAAGGTGTTTGTGCTACTGACTA
TTACTTAGATAAATTTGACAAATATATAAATTCAATAGGCATAAATGAGTATTCTATTAT
GGCTCTGATAGATGCCAGTAACGATAATGGTATTATTCTAACATAAAACAGTAGTATTAT
TAACTTTACTCCATAACAGTTCTTACAATTTTCTCCCTCTTAATGGACAGATATGAAATA
GCAAATACTTTAAACATTTAACAATAATACTAACAGCTTAAATTCTTATAGCTATTTTTA
AGACATTTAAGGATTTAAAGTTGCTGGTTCTGCTTTTAAATCCAAAAATTCAAATGATCA
AACCTTTATTTTATTAGTGAAGGAATCTACAAATTAGTTCGAAAGACTTTACGATACAAT
AATTTAAAGAGTTTAAGATAAATATATTAAACCGAATATTAACTTTATAATCGCATTTCT
AGTGATAAGCTTTGCTCACATTATTTATTGCTTAATAATGAGTTATTATGTTACTCAACC
TTATAGAAAAATAAAGTAGATATCTAACTAAATTACATAGAATTTAAAGGCATCAAATTA
AATAGGATCACTTGATTCATACTTAAACACTTTAGATTTTAAAAGTGATAGAAATTTATA
TATTCTAGTCAAGTCTGCAAAAAAAATGGTTTTAAAAATATAAAAAGCCAGTACTAAGAA
AATAATCGAAAATTAAAAATATTATCATGCTTATCATTATGAGTAAAATGAGTATTTTGA
TAGTCAAATGGAGTGGAGAGATGAAATAGAACAGCTGGTAGATTATGGATTATCAAAAAA
CTTTAATTCACTCCCTACAAACCTAGAATTCTTCAACGATTGTGAATCAAAAATCACTGA
GCTCAGAGATAACTCTCCCTTTGCTATTGTCAACAATAAATAAGAATCGCTAAAAATTAA
ATAAAAAATACTATCTGAAGATTCATTTTGCAAATCTGTCTCTGTTCCATACATTGACTA
AAAGTTCATGAACCACATCGAACAATATCTTCCCAATTTCTAAATGCCCTGA


>TTHERM_00191490(protein)
MQDTLDAKNSYLNFTFSESRIKGISNIKNANLLKNNQATSIMELDQTLQAFHKASHGNLK
NIIKNAEICALDQYSIQNRQQNFETITLNKNKSQSRVSKTEIRSLNPLSCNESEKTKYFE
NEQDNLCNLEDEYENESNYHKNNLESQQSSTQLFANIRQTKIFQQMRDYVRTLKKNKIIQ
KFWFCQINSRWTRQKQLNVSFLMMSICIISILLICWVLLLFFMYRIFDDTYYPNYSESEK
NQLIYTLSSLQESLVSLLRRTDHLHQVAISIYQSQQKGPKNPFYDINFDSHILKGKQNYI
SINQDVSPQFNDTLGFYFQNVDTPITYDFFQWATFIDQRNYTHITPESQKILDDFDILSY
FIKNLIANAKFSFSYSYYCGFETDELVVYYPAGLQNALRGKDKVPDFSFHPNQRDWYSQI
IKNNLQYTNQTYFTLPYKDQITQQYIMTMSVALRDQDGKFQGVCATDYYLDKFDKYINSI
GINEYSIMALIDASNDNGIILTQNSSIINFTPQQFLQFSPSQWTDMKQQILQTFNNNTNS
LNSYSYFQDIQGFKVAGSAFKSKNSNDQTFILLVKESTNQFERLYDTIIQRVQDKYIKPN
INFIIAFLVISFAHIIYCLIMSYYVTQPYRKIKQISNQITQNLKASNQIGSLDSYLNTLD
FKSDRNLYILVKSAKKMVLKIQKASTKKIIENQKYYHAYHYEQNEYFDSQMEWRDEIEQL
VDYGLSKNFNSLPTNLEFFNDCESKITELRDNSPFAIVNNKQESLKIKQKILSEDSFCKS
VSVPYIDQKFMNHIEQYLPNFQMP