Identifiers and Description

Gene Model Identifier

TTHERM_00193230

Standard Name

PDA1 (Pyruvate Dehydrogenase Alpha 1)

Aliases

PreTt06606 | 16.m00262

Description

PDA1 pyruvate dehydrogenase E1 alpha subunit; Pyruvate dehydrogenase complex E1 component; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00676 ) Dehydrogenase E1 component
  • ( PF02775 ) Thiamine pyrophosphate enzyme, C-terminal TPP
  • ( TIGR03181 ) pyruvate dehydrogenase (acetyl-transferring) E1 component,
  • ( TIGR03182 ) pyruvate dehydrogenase (acetyl-transferring) E1 component,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03605.1 9.997093137033517e-262
Description: pyruvate dehydrogenase E1 component (388 aa)
Oxytricha Contig9079.0.0.g83 2.998923500611476e-144
Description: Dehydrogenase E1 component
DictyBase DDB_G0292994 9.995516318087232e-125
Description: pdhA on chromosome: 6 position 2563001 to 2564757
WormBase WBGene00011510 1.000211181581171e-120
Description: locus:pdha-1 Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial status:Confirmed UniProt:P52899 protein_id:CAA87793.1
SGD YER178W 1.0001900614163146e-108
Description: PDA1 E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex, catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA; phosphorylated; regulated by glucose
Stentor Coeruleus SteCoe_7851 1.7785284761271306e-68
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00193230(coding)
ATGAGGTACTAAAGAGTATAATTATTCCTTGCTCAAATCAAAAGAAAGGAAAGAAAGAAA
GAAGAAAAGAAAGAAAAAAAATAAAAATAAAATACAAATAAATAAAATAATCATCAAAAA
GCTAAACTAATGATATCTAAGTTCTTCAATCCTGTTGCTGGTAAGACCTTCAACAGACTT
AACAAGTATGCCTTCTCTTCAGTCACTATTAACCTTGAAGGATACTAGACTAAGATGTTA
GACGGATTCAAATTGCCCACCTAATCAACTGCTACCAAGGAAGAATTATTGAAGCTCTAC
AAAGATATGAACGTTATGAGAAAGATCGAACTTGCATGCGATAAGCTTTATAAGCAAAGA
GAAATTAGAGGTTTCTGCCATCTCTACGACGGTTAAGAAGCTGTTATCTCAGGTATTGAA
GCTGCTTGCAATCTTGAGGATGCAATAATCACTGCCTATAGATGCCATTGTCACGCTTAC
ACAAGAGGTGACACTCCCCATTAAATTATTGCTGAACTTATGGGAAGAAAGACTGGTTCT
ACAGGTGGTAAGGGTGGTTCTATGCACTTCTACAGAAAGAAAACTCACTTCTATGGTGGT
CACGGTATTGTCGGTGCTCAAGTTCCCATGGGTGCTGGATTAGCCTTTGCTTTGAAATAT
GAAAAGAAGCCCAACGTTTCTATCACTATGTACGGTGACGGTGCTGCCAATCAAGGTTAA
ATTGCTGAAGCTGCCAACATGGCTGGTTTATGGAATTTACCATGCTTGTTTGTTTGTGAA
AACAATCTTTACGGTATGGGTACCTCTACTGCAAGAGCTTCTCACAATACTGATTTCTAC
ACCAGAGGTGACAAGATTCCTGGTATCAGAATGGACGGTAATAACTATTTCCATGTTAAG
GAAGGTTTCAAGTTTGCTAAGCAATATGCCTTAGAACATGGTCCTCTCTTCATTGAATTG
AGAACTTACAGATATCACGGTCACTCTATGTCTGACTCCGGTACTACTTATAGAACTCAA
GAAGAAATCAAAGAATTCAGATAAAAGAAGGATTGCATATAATTTATTGCTAATACCATT
TTATAAAATAACTTTGCTACTCAAGAATAACTCGAAGCTATCCAAGATGAAACTAGAGAA
ATTGTTGATAAAGCCGTTGAACAAGCTCTTAAAGACCCATTACCTGATGATCACGAATTG
TGCACCGATGTTTACATTAACAACGATAAATACTACATCAGAGGTATTGAATACGAATAA
GGTTACTTCCCTGAAGGCAAGCCCTACTGA


>TTHERM_00193230(gene)
ATGAGGTACTAAAGAGTATAATTATTCCTTGCTCAAATCAAAAGAAAGGAAAGAAAGAAA
GAAGAAAAGAAAGAAAAAAAATAAAAATAAAATACAAATAAATAAAATAATCATCAAAAA
GCTAAACTAATGATATCTAAGTTCTTCAATCCTGTTGCTGGTAAGACCTTCAACAGACTT
AACAAGTATGCCTTCTCTTCAGTCACTATTAACCTTGTAATTCAATTATTTATTTAATCT
TTTGCTAAGAATATAAATTTAGATAGAAATAGTTTATATTTTTCATTTTTTGACAGAATA
ACTAACTAACTCTCCAATGTTCGAATATTTGATTATATGGCGATAACTACTAAAATATTT
CAAATTCTTGCAAACATTCAACAAAAAAGCTTATAAACTTTAATTTAAATTTACAAAATA
TTTAAGAAAAATAACTTAAATATGATACCAAGCATTTCTTTAGTTAAATATTGCAGTATC
CCACGAATATCCTTATTGTCTAATTTCTGTTTTAAGAAATCTATTTCTACCTAATTATTT
AGCAATCCTAAAACAAAAAAATAGAAAAAAATGATTGCAACTAGAATTTAAATGAAATAA
ATAGTGCTTAACAACCCTTACTTAATCTGATTTTTTTATGAATGATATATGATAGGAAGG
ATACTAGACTAAGATGTTAGACGGATTCAAATTGCCCACCTAATCAACTGCTACCAAGGA
AGAATTATTGAAGCTCTACAAAGATATGAACGTTATGAGAAAGATCGAACTTGCATGCGA
TAAGCTTTATAAGCAAAGAGAAATTAGAGGTTTCTGCCATCTCTACGACGGTTAAGTAAA
TATCATATCATCAATTTTCTTATTATATAGCAAGTTTTTTACATTGACAAGATAACATAA
TGAGATCAATAGTATGACTTTTTAAATTTATAATAAAATATCTTTTAAAAATAATAGGAA
GCTGTTATCTCAGGTATTGAAGCTGCTTGCAATCTTGAGGATGCAATAATCACTGCCTAT
AGATGCCATTGTCACGCTTACACAAGAGGTGACACTCCCCATTAAATTATTGCTGAACTT
ATGGGAAGAAAGACTGGTTCTACAGGTGGTAAGGGTGGTTCTATGCACTTCTACAGAAAG
AAAACTCACTTCTATGGTGGTCACGGTATTGTCGGTGCTCAAGTAAAAATAATTTTCTAA
TTTATTATTTATTTTTCAGATATCATTTTTTCAGTTGTTAATTTAATTGAATAAAGGGAC
ATGGTTTTTTTTTTAAAAAAGTAAGTATCTTTATTCAAAAAATAAAAAATTAATTAAAAA
AAATAAAATTATATCAAAGACCTAGCTTTAATTAATATTCTTAATTTAACAATTTTTTTA
AAAAAAGGTTCCCATGGGTGCTGGATTAGCCTTTGCTTTGAAATATGAAAAGAAGCCCAA
CGTTTCTATCACTATGTACGGTGACGGTGCTGCCAATCAAGGTTAAATTGCTGAAGCTGC
CAACATGGCTGGTTTATGGAATTTACCATGCTTGTTTGTTTGTGAAAACAATCTTTACGG
TATGGGTACCTCTACTGCAAGAGCTTCTCACAATACTGATTTCTACACCAGAGGTGACAA
GATTCCTGGTATCAGAGTAATCAAAATCAAATAAAAATATAAAAGTTGTGTCTAAATAAT
TTTTTAAATCAATAAAAGATGGACGGTAATAACTATTTCCATGTTAAGGAAGGTTTCAAG
TTTGCTAAGCAATATGCCTTAGAACATGGTCCTCTCTTCATTGAATTGAGAACTTACAGA
TATCACGGTCACTCTATGTCTGACTCCGGTACTACTTATAGAACTCAAGAAGAAATCAAA
GAATTCAGATAAAAGAAGGATTGCATATAATTTATTGCTAATACCATTTTATAAAATAAC
TTTGCTACTCAAGAATAACTCGAAGTGATAATTTTAAATTACATTTTTAATAGAAATTAA
AACTTTATTTTTCTCAAAATTAGGCTATCCAAGATGAAACTAGAGAAATTGTTGATAAAG
CCGTTGAACAAGCTCTTAAAGACCCATTACCTGATGATCACGAATTGTGCACCGATGTTT
ACATTAACAACGATAAATGTAAATTGAAAAATTTCCAAAAAAAAATTTATTTAATTTAAT
TTTAACAAATAAAGACTACATCAGAGGTATTGAATACGAATAAGGTTACTTCCCTGAAGG
CAAGCCCTACTGA


>TTHERM_00193230(protein)
MRYQRVQLFLAQIKRKERKKEEKKEKKQKQNTNKQNNHQKAKLMISKFFNPVAGKTFNRL
NKYAFSSVTINLEGYQTKMLDGFKLPTQSTATKEELLKLYKDMNVMRKIELACDKLYKQR
EIRGFCHLYDGQEAVISGIEAACNLEDAIITAYRCHCHAYTRGDTPHQIIAELMGRKTGS
TGGKGGSMHFYRKKTHFYGGHGIVGAQVPMGAGLAFALKYEKKPNVSITMYGDGAANQGQ
IAEAANMAGLWNLPCLFVCENNLYGMGTSTARASHNTDFYTRGDKIPGIRMDGNNYFHVK
EGFKFAKQYALEHGPLFIELRTYRYHGHSMSDSGTTYRTQEEIKEFRQKKDCIQFIANTI
LQNNFATQEQLEAIQDETREIVDKAVEQALKDPLPDDHELCTDVYINNDKYYIRGIEYEQ
GYFPEGKPY