Identifiers and Description

Gene Model Identifier

TTHERM_00193430

Standard Name

FZY4 (FiZzY 4)

Aliases

PreTt06626 | 16.m00282

Description

FZY4 WD-repeat cell cycle regulatory protein; Fizzy/CDC20/CDH1 family protein; homolog of S. cerevisiae CDH1- a cell cycle regulated activator of the anaphase-promoting complex /cyclosome (APC/C)- which directs ubiquitination of various targets; WD regulatory protein related

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03621.1 9.997093137033517e-262
Description: WD regulatory protein (729 aa)
Oxytricha Contig5638.0.g55 1.000008670162283e-147
Description: WD domain, G-beta repeat
WormBase WBGene00001510 5.9971580238050325e-115
Description: locus:fzr-1 status:Partially_confirmed UniProt:Q09649 protein_id:CAA87433.1
DictyBase DDB_G0287259 1.0000943968537097e-101
Description: cdh1 on chromosome: 5 position 54882 to 57146
SGD YGL003C 1.0003180480544985e-86
Description: CDH1 Cell-cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C), which directs ubiquitination of cyclins resulting in mitotic exit; targets the APC/C to specific substrates including Cdc20p, Ase1p, Cin8p and Fin1p
Stentor Coeruleus SteCoe_23149 6.375869581278994e-59
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00193430(coding)
ATGGAAGAATAAGTCTACTAGAAAGAAGCAGATTAGCTCTAGGAAAGTTTGAAGTTTTAT
GATCCAGATACTAAGAAGATAAGAGGTTATCTTTCAGATAAAACTAATTCAGATGAATAC
AACAGGGTTCATAATAACTTTAATGTCTCCGCTTCAAATAATTACCCAAATTTCTATTCA
AGCAACAATACCTAAATGTATTTTAACAGTATTAATGACAACCAAAGTGTTTCAAATACA
TTATAATAATCTTAAAATAACTCCAAATTTCCAAATAATCATATAGAAAATTAGCAATCT
GTCCATTAACAAACTAATTTTAACTAAAATAGTAAGGTTGGTGAAGAATGCCTTAAATAG
CCATATTTATTTTAGGTAAAACCCATTATTTTTGACCAAAGCAGCTATAATTACTAGGAG
GAAGAAAATTAGGTTTGGAAAGTAAATAAAAAGTTGCAGAGCGAAGCAAGTGAGAGTTTA
TGCCAAACTAAAACAGAATTAAATAAAGCACCATCAATTTACTTAAGCCAAGAACTAGTA
AGTTCTGATAGCAGTATAGGACACATTTTTAATGAAAATGCATTGAATATGGATAAAAAT
TAATCCCAGTAAATAGATAGCGATAAGACTTAGATTTACTTTCAAACATATGAGAATTTA
TCAAATAATGAAAGCACACCTAGTCATTCATAATAATCTAGCCTGTAAATCATAAATAAT
GAGAATAGCAGTTAGCTAGAAATAAAAAGTAATGCAAGCGGATAAAAGTAGAAAAGTAGT
GGTAAAAAATACAATGATAGGTACATTCCTAATAGAGTTTCAACAAATTTATATAATTTG
ATAAATCCAACTCAACTCTCTTCTTCCTCTTCCTAATAAAATTCAAATAGCAGTTAATAA
CCAAATGGAGATGAGATTGATGATGGAACCATGAGGAGATAATCAGATAATCCAAGAGTT
TAGCAAAATTCAAAGTTGTATTCCAACCTCCTCTAGTCTTCAATTTTAGGAGAATCGCCT
GAACTTCTTCAATAGAGCCGTCACTGGGGCTCATCTAATGCAGATTATATTCTTAAAGAC
TCCCAAATGATAAATTATGGCTAAATAAATGCATATTAAACATACAAATAAAAAAAGATA
TTAACTTACAGCACTAAGCAGTAAATATAAAATTATGAAAATGAACTTAAAATTGCTGCA
CATAATTAAATTATTCTGTCACATGAATAAAATATCAGAAAAATACCTAAACAACCCTAT
AAAATTTTAGAATCAAGAAATTTACAAGATGACTTTTATTTGAATCTACTGGATTGGTCT
CCTCTTAATTATCTAGCAGTTGGATTGAAAAATTAAGTTGCAATATGGTCAGGTTGTAAC
TCAACTATTTCAAGACTCTGTGGTCTTGGAGATGTTGGTGTTAGTTCAGTTTCTTGTAGC
TAGCGCAGTAACCATATAGCAGTTGGTGATTCAATTGGAAATATACTTATTTATGACATT
CATCATAAAGAGCAACCACTATTAAAAATAGACGGTCACTCCGATAGAATCGGCAGTATA
GCTTGGAACGGATCACTGATTGCATCAGGATCTAAAGATAAAAACATCTTAGTAAGAGAT
TTGAGAGCTCCTTAGAAATATATATAGAAATACTCAGGGCATAAATAAGAAATATGTGGA
CTAAAATGGTCGTTTGATGAAAATATCTTAGCTTCAGGAGGTAATGACAATAAGCTATTT
TTATGGACTTTGAAAACAAAAGACGAGCTAGCTAAGTTTTCACAACATACAGCAGCTGTT
AAAGCTTTAGGTTTTTCTCCACATCAACACAATATTTTGGCTAGTGGAGGAGGTACAGCA
GACAGATGCATTAGATTTTGGAACACATAGACACTTTAGTAAATTGACTGTTTAGATACA
GGTTCTCAAGTTTGCAATCTGATGTTTTCAAAAAATGTTAATGAAATAGTATCAACACAT
GGCTATAGTCTAAATTAGATTATAGTTTGGAAATATCCTTCAATGAAAAAAATTTAAACT
TTGACAGGACACACATAAAGAGTTCTTTATTTAGCTATGAGTCCTTGTGGATAGAATGTA
GTGACAGGAGCTGGTGATGAAACACTTCGCTTCTGGAATATATTCCCATCTGTAAAAAAT
AAATCAAACTTATTAGGAACTAGTTCTCTTTTCCCATCTTGCATAGACTTAAGGTGA


>TTHERM_00193430(gene)
ATGGAAGAATAAGTCTACTAGAAAGAAGCAGATTAGCTCTAGGAAAGTTTGAAGTTTTAT
GATCCAGATACTAAGAAGATAAGAGGTTATCTTTCAGATAAAACTAATTCAGATGAATAC
AACAGGGTTCATAATAACTTTAATGTCTCCGCTTCAAATAATTACCCAAATTTCTATTCA
AGCAACAATACCTAAATGTATTTTAACAGTATTAATGACAACCAAAGTGTTTCAAATACA
TTATAATAATCTTAAAATAACTCCAAATTTCCAAATAATCATATAGAAAATTAGCAATCT
GTCCATTAACAAACTAATTTTAACTAAAATAGTAAGGTTGGTGAAGAATGCCTTAAATAG
CCATATTTATTTTAGGTAAAACCCATTATTTTTGACCAAAGCAGCTATAATTACTAGGAG
GAAGAAAATTAGGTTTGGAAAGTAAATAAAAAGTTGCAGAGCGAAGCAAGTGAGAGTTTA
TGCCAAACTAAAACAGAATTAAATAAAGCACCATCAATTTACTTAAGCCAAGAACTAGTA
AGTTCTGATAGCAGTATAGGACACATTTTTAATGAAAATGCATTGAATATGGATAAAAAT
TAATCCCAGTAAATAGATAGCGATAAGACTTAGATTTACTTTCAAACATATGAGAATTTA
TCAAATAATGAAAGCACACCTAGTCATTCATAATAATCTAGCCTGTAAATCATAAATAAT
GAGAATAGCAGTTAGCTAGAAATAAAAAGTAATGCAAGCGGATAAAAGTAGAAAAGTAGT
GGTAAAAAATACAATGATAGGTACATTCCTAATAGAGTTTCAACAAATTTATATAATTTG
ATAAATCCAACTCAACTCTCTTCTTCCTCTTCCTAATAAAATTCAAATAGCAGTTAATAA
CCAAATGGAGATGAGATTGATGATGGAACCATGAGGAGATAATCAGATAATCCAAGAGTT
TAGCAAAATTCAAAGTTGTATTCCAACCTCCTCTAGTCTTCAATTTTAGGAGAATCGCCT
GAACTTCTTCAATAGAGCCGTCACTGGGGCTCATCTAATGCAGATTATATTCTTAAAGAC
TCCCAAATGATAAATTATGGCTAAATAAATGCATATTAAACATACAAATAAAAAAAGATA
TTAACTTACAGCACTAAGCAGTAAATATAAAATTATGAAAATGAACTTAAAATTGCTGCA
CATAATTAAATTATTCTGTCACATGAATAAAATATCAGAAAAATACCTAAACAACCCTAT
AAAATTTTAGAATCAAGAAATTTACAAGATGACTTTTATTTGAATCTACTGGATTGGTCT
CCTCTTAATTATCTAGCAGTTGGATTGAAAAATTAAGTTGCAATATGGTCAGGTTGTAAC
TCAACTATTTCAAGACTCTGTGGTCTTGGAGATGTTGGTGTTAGTTCAGTTTCTTGTAGC
TAGCGCAGTAACCATATAGCAGTTGGTGATTCAATTGGAAATATACTTATTTATGACATT
CATCATAAAGAGCAACCACTATTAAAAATAGACGGTCACTCCGATAGAATCGGCAGTATA
GCTTGGAACGGATCACTGATTGCATCAGGATCTAAAGATAAAAACATCTTAGTAAGAGAT
TTGAGAGCTCCTTAGAAATATATATAGAAATACTCAGGGCATAAATAAGTAAAATATTTT
TTTTTACAAAAAAAATGAACAAATTTTTATACAATCAAAATTCTTCAATTAGAATATAAT
ATGATGAATAATAAATTAATTGTTGTTCTTCTTTTCTACTTTTTAATTTAAAATTAGTAT
TAAATTTATTACTCAATAATAAAACAAAACTAACACAATTTAATTTATTTATTTTTTATT
TGATCAATAAAATTTGATACAAATTTTCAACAAAACTTCAATTCAAGTAGAACTAATTTA
CAATTAATTATTTCTTAAAAACGCAATAAACTGTAAGATTTCAATATTAATTGACCAGAA
TATCAAATTTATAAAATTTAATATCTAATTTTAATTTTATAAAAATTTTAAATGTTAATA
ATTAATTTTATTCCAACATATTGATAAATTTAGAGTATGTTCAATATTTTAAATGTTAAA
AAAATATATTTTTTTTTATTAATTAATTTTTATTTATTTTAGGAAATATGTGGACTAAAA
TGGTCGTTTGATGAAAATATCTTAGCTTCAGGAGGTAATGACAATAAGCTATTTTTATGG
ACTTTGAAAACAAAAGACGAGCTAGCTAAGTTTTCACAACATACAGCAGCTGTTAAAGCT
TTAGGTTTTTCTCCACATCAACACAATATTTTGGCTAGTGGAGGAGGTACAGCAGACAGA
TGCATTAGATTTTGGAACACATAGACACTTTAGTAAATTGACTGTTTAGATACAGGTTCT
CAAGTTTGCAATCTGATGTTTTCAAAAAATGTTAATGAAATAGTATCAACACATGGCTAT
AGTCTAAATTAGATTATAGTTTGGAAATATCCTTCAATGAAAAAAATTTAAACTTTGACA
GGACACACATAAAGAGTTCTTTATTTAGCTATGAGTCCTTGTGGATAGAATGTAGTGACA
GGAGCTGGTGATGAAACACTTCGCTTCTGGAATATATTCCCATCTGTAAAAAATAAATCA
AACTTATTAGGAACTAGTTCTCTTTTCCCATCTTGCATAGACTTAAGGTGA


>TTHERM_00193430(protein)
MEEQVYQKEADQLQESLKFYDPDTKKIRGYLSDKTNSDEYNRVHNNFNVSASNNYPNFYS
SNNTQMYFNSINDNQSVSNTLQQSQNNSKFPNNHIENQQSVHQQTNFNQNSKVGEECLKQ
PYLFQVKPIIFDQSSYNYQEEENQVWKVNKKLQSEASESLCQTKTELNKAPSIYLSQELV
SSDSSIGHIFNENALNMDKNQSQQIDSDKTQIYFQTYENLSNNESTPSHSQQSSLQIINN
ENSSQLEIKSNASGQKQKSSGKKYNDRYIPNRVSTNLYNLINPTQLSSSSSQQNSNSSQQ
PNGDEIDDGTMRRQSDNPRVQQNSKLYSNLLQSSILGESPELLQQSRHWGSSNADYILKD
SQMINYGQINAYQTYKQKKILTYSTKQQIQNYENELKIAAHNQIILSHEQNIRKIPKQPY
KILESRNLQDDFYLNLLDWSPLNYLAVGLKNQVAIWSGCNSTISRLCGLGDVGVSSVSCS
QRSNHIAVGDSIGNILIYDIHHKEQPLLKIDGHSDRIGSIAWNGSLIASGSKDKNILVRD
LRAPQKYIQKYSGHKQEICGLKWSFDENILASGGNDNKLFLWTLKTKDELAKFSQHTAAV
KALGFSPHQHNILASGGGTADRCIRFWNTQTLQQIDCLDTGSQVCNLMFSKNVNEIVSTH
GYSLNQIIVWKYPSMKKIQTLTGHTQRVLYLAMSPCGQNVVTGAGDETLRFWNIFPSVKN
KSNLLGTSSLFPSCIDLR