Identifiers and Description

Gene Model Identifier

TTHERM_00194500

Standard Name

NPA3  (Nucleolar Preribosomal Associated )

Aliases

PreTt06734 | 16.m00390

Description

ATP-binding protein putative; GPN-loop GTPase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01926 ) GTPase of unknown function
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( PF03234 ) Cdc37 family
  • ( TIGR00073 ) hydrogenase accessory protein HypB

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03725.1 9.997093137033517e-262
Description: hypothetical protein (358 aa)
WormBase WBGene00001661 8.00096947334534e-83
Description: locus:gop-2 GPN-loop GTPase 1 homolog status:Confirmed UniProt:P46577 protein_id:CCD66646.1
DictyBase DDB_G0293220 1.9996609186508915e-82
Description: gpn1 on chromosome: 6 position 2684279 to 2685723
SGD YJR072C 9.001511723580574e-81
Description: NPA3 Essential, conserved, cytoplasmic ATPase; phosphorylated by the Pcl1p-Pho85p kinase complex
Oxytricha Contig15609.0.g93 4.000308233752481e-69
Description: Conserved hypothetical ATP binding protein
Stentor Coeruleus SteCoe_3377 4.906094730649281e-35
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00194500(coding)
ATGGAAGAAGAAAAAAGTCAACAAACTAGCACTCCTTAGACTGAGTAGACCTAGAAAGTA
CCAGGAGGATTAAATATTAACACTGAGAGAGTTTCTTTATTAACAATAGGTATGGCAGGA
AGTGGAAAAACAACATTCGTTAGATCTTTAGTATAGTATTTATTATTCTCTCAATAAGAC
CCTGCCTACGTTTTAAATTTAGATCCAGCTGTTTAATTTTTACCATATACTCCAAATGGT
GACATTAGACAAACAATAGATTATAAAAAATTAATGAAAGAACATTAACTTGGTCCAAAC
GGTGCAATTATGACAGCATTAAATCTCTTTTGTGCATAAATTGATGAAACTATTAACAAT
ATAGAGGCTACTAGTCATACTTCTAAGCATGTAGTAGTTGATACTCCAGGATAAATCGAA
GTTTTTACCTGGAGCGCATCAGGTTCTATAATTACTCAAACTCTCCTTACATCTATGCCT
ACTGTTCTTTTATATGTTCTTGATTTAGCTAGATGTTAAAATCCAAACAGTTTTATGAGC
AATATGATGTTCTGCTGTAGTATATTTTATAAAATGAAGCTTCCAATGATCATAGTCTTA
AATAAAGAAGACGCTGCTGATAAAGAAAAAGTTTTGGGTTGGATTAGAGATTACTAAAAA
CTTCTTGAAGAATTTTAAAATTATGATTCATATCTTTCTACCTTTAGCAAATCTATGGTC
TTAAGTTTGGATGAATTTTATAACTAATTGAGAGTTGTCGCAGTAAGCTCCCTTAAAATG
ACAGGATTTGATTAGTTAAAAGAAGCAATAGCTAGTGCAAAATAAGAATTTATGGATGTT
TAATACAAAGATCTCGTTAAAAACTACAATAGAAGGATGGCTGAAGAATAAGAAAAGTAA
TAAAAAGAATTAAAGAAGTTTATGAAAGATTATAAGAAAACTGAAGAGTAAAATAAAAAG
AAAAAACCAGAAGCTCCTTTAAATGTTTAAGTTAGCCATGTTGGACCAACTAAATCTAAA
AAAGATGATGAAGAGAAAGAAATCAAAAAAGCTGAAGAAAAGATTTAAAAAATGAATATC
GAATGA


>TTHERM_00194500(gene)
ATGGAAGAAGAAAAAAGTCAACAAACTAGCACTCCTTAGACTGAGTAGACCTAGAAAGTA
CCAGGAGGATTAAATATTAACACTGAGAGAGTTTCTTTATTAACAATAGGTATGGCAGGA
AGTGGAAAAACAACATTCGTTAGAGTAAAATTTTTATAAAATAAATTTTAGAATTATAGT
TTAAAAAGAGTAGAATTTGAAAAGCTAGCTTATTTACTTTATAAATAATTAAATAGTCTT
TAGTATAGTATTTATTATTCTCTCAATAAGACCCTGCCTACGTTTTAAATTTAGATCCAG
CTGTTTAATTTTTACCATATACTCCAAATGGTGACATTAGACAAACAATAGATTATAAAA
AATTAATGAAAGAACATTAACTTGGTCCAAACGGTGCAATTATGACAGCATTAAATCTCT
TTTGTGCATAAATTGATGAAACTATTAACAATATAGAGGCTACTAGTCATACTTCTAAGC
ATGTAGTAGTTGATACTCCAGGATAAATCGAAGTTTTTACCTGGAGCGCATCAGGTTCTA
TAATTACTCAAACTCTCCTTACATCTATGCCTACTGTAATATATATAAAAAATGAATTTG
TTTATTAACACCATTTTAAAGAGGGAATATTATAGATAGAGTGGCATTTAAATTTTATTA
TTTACTAGCATAAGTATTTATTTATCTAAAAAATTTTAATATTTTATAAAATTATAGGTT
CTTTTATATGTTCTTGATTTAGCTAGATGTTAAAATCCAAACAGTTTTATGAGCAATATG
ATGTTCTGCTGTAGTATATTTTATAAAATGAAGCTTCCAATGATCATAGTCTTAAATAAA
GAAGACGCTGCTGATAAAGAAAAAGTTTTGGGTTGGATTAGAGATTACTAAAAACTTCTT
GTAATTCACAATTTAAAAATAAATTTAGAAGTATATATTTATTAAATAAATAGGAAGAAT
TTTAAAATTATGATTCATATCTTTCTACCTTTAGCAAATCTATGGTCTTAAGTTTGGATG
AATTTTATAACTAATTGAGAGTAAGTATTAGACTTTTATTAAAATTCATTAATTATTTGC
TTTTATTTGAAAGGTTGTCGCAGTAAGCTCCCTTAAAATGACAGGATTTGATTAGTTAAA
AGAAGCAATAGCTAGTGCAAAATAAGAATTTATGGAGTAAATTTAATTAATATTAAAGAG
TGAAATTAAAAAAAAATATTTACAGTGTTTAATACAAAGATCTCGTTAAAAACTACAATA
GAAGGATGGCTGAAGAATAAGAAAAGTAATAAAAAGAATTAAAGAAGTTTATGAAAGATT
ATAAGAAAACTGAAGAGTAAAATAAAAAGAAAAAACCAGAAGCTCCTTTAAATGTTTAAG
TTAGCCATGTTGGACCAACTAAATCTAAAAAAGATGATGAAGAGAAAGGTAATAAAATAA
AATAAAACCAAAAAACAAAAATATAAAATTTATTATGATAAAAAATAGAAATCAAAAAAG
CTGAAGAAAAGATTTAAAAAATGAATATCGAATGA


>TTHERM_00194500(protein)
MEEEKSQQTSTPQTEQTQKVPGGLNINTERVSLLTIGMAGSGKTTFVRSLVQYLLFSQQD
PAYVLNLDPAVQFLPYTPNGDIRQTIDYKKLMKEHQLGPNGAIMTALNLFCAQIDETINN
IEATSHTSKHVVVDTPGQIEVFTWSASGSIITQTLLTSMPTVLLYVLDLARCQNPNSFMS
NMMFCCSIFYKMKLPMIIVLNKEDAADKEKVLGWIRDYQKLLEEFQNYDSYLSTFSKSMV
LSLDEFYNQLRVVAVSSLKMTGFDQLKEAIASAKQEFMDVQYKDLVKNYNRRMAEEQEKQ
QKELKKFMKDYKKTEEQNKKKKPEAPLNVQVSHVGPTKSKKDDEEKEIKKAEEKIQKMNI
E