Identifiers and Description

Gene Model Identifier

TTHERM_00196110

Standard Name

MRNC22 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt06796 | 16.m00452

Description

kinase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03791.1 9.997093137033517e-262
Description: hypothetical protein (871 aa)
Oxytricha Contig1068.0.0.g83 0.000000000000001999258566166494
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196110(coding)
ATGACAAATCGTGTCAACTACCTTTATTCTGATTACAAGGGATATGGCTTGTAATAAGGA
ATTTCTTTGACAGCATAAAAAAATGGCGCAATCACTTAAACATCTAGCTTTAACTACTAA
CCTGTTGCAAAAGAAAATATATCAACATTAGGCTAAATTTCTAATTAACCTTTGTACTAA
TAAATTTAATACTCAACATAATCAGGTCGCACAGTTCAAAGGACTGCTTCACCAATGATT
ATTCAGCATCCTAGTAGATATGGAACAAATAATGCAAATTTAAGCACCTCACCAAATCAG
TCTAGTGCAACTAGTGCAACGAAATATTAAGTTCCTTCTTACTAGAATAATGGCGGTTTA
TCAACTAATTTTTCATATTCTGCAGAAAAAAGCACAACCTCTAATGGAACAGAAGCTATA
TCTCGTCCTTCTATAGGAGCTTCATATCTTTCATCCTAAAACAATAACTAATTTAATAAT
AGTTAAGCACTTCGTTCTCCATATGTCTCTAGTTTTACTTCTAATTTGACATCCAGTTAA
ATGAATGGTACTTCCAATTCTAACTCTAATCCTAGCGGAGCGTAAGTTACCCATCATCAT
GGAAGATCAATAAGTATGTTTTCAGGCTAAAATTATACAGCTCCTTCTATAGCCTAGAGC
TTATCTCTTTCCATTGGAACTTAATCAAATTAACCATCATCAACTAATTAGTCTTCATTA
GCAAGTGGAAATGTAGCAAATCTAGGTAATAATTAAAATAACTCTACTTCATTTTCATAA
GTTTATACCTCACTATCAGCAAACAATAAAGTAGCCTTGAATAATAATTTAAGCAGTGGT
GTAAATGGATAAATTGTTGGTGATAGAAGTATAAGCTATACAGGAAGCAGTGCCTATCCT
CAAATAAATACATAAAGTATAGAAAATTTTTACTAGCAGAATAGCTAGCCTTCAAATGAG
TAACTTAACAGATCAGATTCATTATCTCCAAGTAAGCGTGTTACTTTTAATTTAGCTCGT
AATACTTACACAGATATAGAGTAAATTGAAAAGCGTTTAAATGAGTCTACTAGATTAAGA
CCTGCAGATGAAGTAGAAGACAGTAGAGATAGAACCCCAACAGCAACCTTTGGCCATAAC
CATATATATGAAGATGATTTGAGCAAGAGATTCGATTAAGCTATTTTCCGCAGTGAGAGA
ATCATTTCTGATTGCCTTCGCATTGGAAGAGAAGGTCAGCAATACAAAAATGCATTAGAA
AATAGCACAGTAGCAAATGGATCTACAACACCAAATGGTCCAAAAATGATCCGCAATCCA
AGTAGAAGTAAAAGTCCAATAAAATCAAGCTTAAAGAGAACTTCTAGTTTTACTGGTAGT
CCTTAAAAATCTGTAAACACTACTCCTAGCACTTATTAAGCTGCATAAGATACTAATTTA
GCTGCTTCTTAAAATTTGTAGAAATTTAGTGATGCCTTTGAAAATCCACTAACAAACCAA
ACTAATAAAATTATCAACAATATTCATACAACAACTGAGACTATTTATTCCTCCAAATAA
GCAGCTTCACCATATCTTTAGAGTAATTCTTCATCAGAAAAGACTCCATAATCTTTAACT
AATAATTCAGCTTCAACTGTGGTTTCTTCAACAAACTCATCTCAGATTTCTGTTCCCTCT
TACTTGGCCTAAACTTCATCCTTGAATAGCCAAAATCCCGAAAAACAAGTACCTTTATCA
AGCTAAACCACATATGTCTCTTCTTCAACAAAATAAGTTGGACTTACTAATTCAGTCACT
GATGAAAATCAATTTGTAGCATCCTCATCTAATGTAAATAAAGCTATTACTTCATCTAAG
CCTTACAGTGCACAAGAAAATGGAATTTCTTCAAGCGTGTACTCTGTGACTTCAGCATAT
AATACATCTCTATTATCTTCTACATAAAATACAAACCCATAAAAAGCATCTTATCTATCA
AAAGTTTCATCATCAAAAGAAAATGAGCAATAAAGTGTCTCAAGTTAAAATAAAGCTCCA
TCTTAAGTAGAATTTACCTCTATTGCTTTAAAAAAGAGTGAATCTGAGGTAGTAGATTAA
AATCAAAATAAACAAGATAAATAATAAAATGATGCAAAGAGATTAAGCTTGCAACCAACT
TCTGCTACAAAGCCTCGCCAAGGTATCTTAAGATATTCAGATGGATCCAGATATGATGGA
GAAATCTTAAATAATTAAAGACATGGGTACGGTACTTTGCTTAGTAGTGATTTCTAAGTT
ATTTATTAAGGAGATTGGTAAAATGATACCTATCATGGATAAGGTAAATTCTTCAATCCC
TTAGCAGAAAACCTCTTTGATGAATATGAATATAGTGATTTTGATGTTGCTTTGAGTCAA
TACTGGGAATCATATGAAGGAGAATTTTATGAAGGTAAATTAGATGGTTTTGGAACTTTG
ATGCTTACAAATGGTGAAAAGCTAGTAGGAAATTTCAAAAAAGGTCGTATCTGTGGAAAA
GGAACCTTTTACTGCAATAAAGGACCAGCCGTTACAGGTAACTGGGAAGACAATCGCTTA
TTAGAAAAGTATTGA


>TTHERM_00196110(gene)
ATGACAAATCGTGTCAACTACCTTTATTCTGATTACAAGGGATATGGCTTGTAATAAGGA
ATTTCTTTGACAGCATAAAAAAATGGTAAACTTATTCATTTGAAAAATTATCACCAATTA
AATTTTTATTTAAAAAAGGCGCAATCACTTAAACATCTAGCTTTAACTACTAACCTGTTG
CAAAAGAAAATATATCAACATTAGGCTAAATTTCTAATTAACCTTTGTACTAATAAATTT
AATACTCAACATAATCAGGTCGCACAGTTCAAAGGACTGCTTCACCAATGATTATTCAGC
ATCCTAGTAGATATGGAACAAATAATGCAAATTTAAGCACCTCACCAAATCAGTCTAGTG
CAACTAGTGCAACGAAATATTAAGTTCCTTCTTACTAGAATAATGGCGGTTTATCAACTA
ATTTTTCATATTCTGCAGAAAAAAGCACAACCTCTAATGGAACAGAAGCTATATCTCGTC
CTTCTATAGGAGCTTCATATCTTTCATCCTAAAACAATAACTAATTTAATAATAGTTAAG
CACTTCGTTCTCCATATGTCTCTAGTTTTACTTCTAATTTGACATCCAGTTAAATGAATG
GTACTTCCAATTCTAACTCTAATCCTAGCGGAGCGTAAGTTACCCATCATCATGGAAGAT
CAATAAGTATGTTTTCAGGCTAAAATTATACAGCTCCTTCTATAGCCTAGAGCTTATCTC
TTTCCATTGGAACTTAATCAAATTAACCATCATCAACTAATTAGTCTTCATTAGCAAGTG
GAAATGTAGCAAATCTAGGTAATAATTAAAATAACTCTACTTCATTTTCATAAGTTTATA
CCTCACTATCAGCAAACAATAAAGTAGCCTTGAATAATAATTTAAGCAGTGGTGTAAATG
GATAAATTGTTGGTGATAGAAGTATAAGCTATACAGGAAGCAGTGCCTATCCTCAAATAA
ATACATAAAGTATAGAAAATTTTTACTAGCAGAATAGCTAGCCTTCAAATGAGTAACTTA
ACAGATCAGATTCATTATCTCCAAGTAAGCGTGTTACTTTTAATTTAGCTCGTAATACTT
ACACAGATATAGAGTAAATTGAAAAGCGTTTAAATGAGTCTACTAGATTAAGACCTGCAG
ATGAAGTAGAAGACAGTAGAGATAGAACCCCAACAGCAACCTTTGGCCATAACCATATAT
ATGAAGATGATTTGAGCAAGAGATTCGATTAAGCTATTTTCCGCAGTGAGAGAATCATTT
CTGATTGCCTTCGCATTGGAAGAGAAGGTCAGCAATACAAAAATGCATTAGAAAATAGCA
CAGTAGCAAATGGATCTACAACACCAAATGGTCCAAAAATGATCCGCAATCCAAGTAGAA
GTAAAAGTCCAATAAAATCAAGCTTAAAGAGAACTTCTAGTTTTACTGGTAGTCCTTAAA
AATCTGTAAACACTACTCCTAGCACTTATTAAGCTGCATAAGATACTAATTTAGCTGCTT
CTTAAAATTTGTAGAAATTTAGTGATGCCTTTGAAAATCCACTAACAAACCAAACTAATA
AAATTATCAACAATATTCATACAACAACTGAGACTATTTATTCCTCCAAATAAGCAGCTT
CACCATATCTTTAGAGTAATTCTTCATCAGAAAAGACTCCATAATCTTTAACTAATAATT
CAGCTTCAACTGTGGTTTCTTCAACAAACTCATCTCAGATTTCTGTTCCCTCTTACTTGG
CCTAAACTTCATCCTTGAATAGCCAAAATCCCGAAAAACAAGTACCTTTATCAAGCTAAA
CCACATATGTCTCTTCTTCAACAAAATAAGTTGGACTTACTAATTCAGTCACTGATGAAA
ATCAATTTGTAGCATCCTCATCTAATGTAAATAAAGCTATTACTTCATCTAAGCCTTACA
GTGCACAAGAAAATGGAATTTCTTCAAGCGTGTACTCTGTGACTTCAGCATATAATACAT
CTCTATTATCTTCTACATAAAATACAAACCCATAAAAAGCATCTTATCTATCAAAAGTTT
CATCATCAAAAGAAAATGAGCAATAAAGTGTCTCAAGTTAAAATAAAGCTCCATCTTAAG
TAGAATTTACCTCTATTGCTTTAAAAAAGAGTGAATCTGAGGTAGTAGATTAAAATCAAA
ATAAACAAGATAAATAATAAAATGATGCAAAGAGATTAAGCTTGCAACCAACTTCTGCTA
CAAAGCCTCGCCAAGGTATCTTAAGATATTCAGATGGATCCAGATATGATGGAGAAATCT
TAAATAATTAAAGACATGGGTACGGTACTTTGCTTAGTAGTGATTTCTAAGTTATTTATT
AAGGAGATTGGTAAAATGATACCTATCATGGATAAGGTAAATTCTTCAATCCCTTAGCAG
AAAACCTCTTTGATGAATATGAATATAGTGATTTTGATGTTGCTTTGAGTCAATACTGGG
AATCATATGAAGGAGAATTTTATGAAGGTAAATTAGATGGTTTTGGAACTTTGATGCTTA
CAAATGGTGAAAAGCTAGTAGGAAATTTCAAAAAAGGTCGTATCTGTGGAAAAGGAACCT
TTTACTGCAATAAAGGACCAGCCGTTACAGGTAACTGGGAAGACAATCGCTTATTAGAAA
AGTATTGA


>TTHERM_00196110(protein)
MTNRVNYLYSDYKGYGLQQGISLTAQKNGAITQTSSFNYQPVAKENISTLGQISNQPLYQ
QIQYSTQSGRTVQRTASPMIIQHPSRYGTNNANLSTSPNQSSATSATKYQVPSYQNNGGL
STNFSYSAEKSTTSNGTEAISRPSIGASYLSSQNNNQFNNSQALRSPYVSSFTSNLTSSQ
MNGTSNSNSNPSGAQVTHHHGRSISMFSGQNYTAPSIAQSLSLSIGTQSNQPSSTNQSSL
ASGNVANLGNNQNNSTSFSQVYTSLSANNKVALNNNLSSGVNGQIVGDRSISYTGSSAYP
QINTQSIENFYQQNSQPSNEQLNRSDSLSPSKRVTFNLARNTYTDIEQIEKRLNESTRLR
PADEVEDSRDRTPTATFGHNHIYEDDLSKRFDQAIFRSERIISDCLRIGREGQQYKNALE
NSTVANGSTTPNGPKMIRNPSRSKSPIKSSLKRTSSFTGSPQKSVNTTPSTYQAAQDTNL
AASQNLQKFSDAFENPLTNQTNKIINNIHTTTETIYSSKQAASPYLQSNSSSEKTPQSLT
NNSASTVVSSTNSSQISVPSYLAQTSSLNSQNPEKQVPLSSQTTYVSSSTKQVGLTNSVT
DENQFVASSSNVNKAITSSKPYSAQENGISSSVYSVTSAYNTSLLSSTQNTNPQKASYLS
KVSSSKENEQQSVSSQNKAPSQVEFTSIALKKSESEVVDQNQNKQDKQQNDAKRLSLQPT
SATKPRQGILRYSDGSRYDGEILNNQRHGYGTLLSSDFQVIYQGDWQNDTYHGQGKFFNP
LAENLFDEYEYSDFDVALSQYWESYEGEFYEGKLDGFGTLMLTNGEKLVGNFKKGRICGK
GTFYCNKGPAVTGNWEDNRLLEKY