Identifiers and Description

Gene Model Identifier

TTHERM_00201700

Standard Name

RAB50 (RAB GTPase 50)

Aliases

PreTt13741 | 17.m00348

Description

RAB50 Ras family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_41344.1 9.997975313387782e-28
Description: hypothetical protein (168 aa)
Oxytricha Contig6560.0.g89 4.999245259173412e-21
Description: Ras family
WormBase WBGene00004276 1.000116773704384e-19
Description: locus:rab-14 status:Confirmed UniProt:Q93874 protein_id:CAB01884.1
DictyBase DDB_G0281337 4.998394530072393e-19
Description: rab14 on chromosome: 3 position 4383385 to 4384571
SGD YFL005W 4.997543945741262e-17
Description: SEC4 Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00201700(coding)
ATGTTTGCTAAAAAAGGCAGTTAATAAAAAAGTATAATATGTATTTCTGTAGGAGATGCA
AATGTTGGAAAATCTTCTATATTTGCAAGGCAATTTTATGGAGAGGTTCCTCAATAAAAT
TCCCTCTATGTTGATTATTCAACCATATTGGTGAGAAAAGGAAATGAAGAGATTTAATTT
AAATTTTGGGTCATAAATCACCTTCACAAACATTTAACATCATAATATTATAGAACTTCT
ATTTTAATTATGATTTACGATATTACAAGCAGAGACTCATTTACACATATTTAATATTAT
TATGAAGATTATGTTAAAAAATGTAATATAAAATCAATAATTGCTCTTGTTGGAAATAAG
AAGGATCTAAATGAGTTTAGATAAGTTTCATTTTAGGAGGGTTAAGATCTAGCCAAATCA
TTAGGTGTAGATTTTTTTGAAGTATCTGCTTTTACAGGTGATAAAGTAAAAGATTTGTAT
GACTTTTTAATAAACTAGTCTTTTGATACAGCTAATTTTGAATGA


>TTHERM_00201700(gene)
ATGTTTGCTAAAAAAGGCAGTTAATAAAAAAGTATAATATGTATTTCTGTAGGAGATGCA
AATGTTGGAAAATCTTCTATATTTGCAAGGCAATTTTATGGAGAGGTTCCTCAATAAAAT
TCCCTCTATGTTGATTATTCAACCATATTGGTGAGAAAAGTAAAATACATATTTCAAATT
TAGTTTTTTTAGTAGATTTTAAACATTTTAGGGAAATGAAGAGATTTAATTTAAATTTTG
GGTCATAAATCACCTTCACAAACATTTAACATCATAATATTATAGAACTTCTATTTTAAT
TATGATTTACGATATTACAAGCAGAGACTCATTTACACATATTTAATATTATTATGAAGA
TTATGTTAAAAAATGTAATATAAAATCAATAATTGCTCTTGTTGGAAATAAGAAGGATCT
AAATGAGTTTAGATAAGTTTCATTTTAGGAGGGTTAAGATCTAGCCAAATCATTAGGTGT
AGATTTTTTTGAAGTATCTGCTTTTACAGGTGATAAAGTAAAAGATTTGTATGACTTTTT
AATAAACTAGTCTTTTGATACAGCTAATTTTGAATGA


>TTHERM_00201700(protein)
MFAKKGSQQKSIICISVGDANVGKSSIFARQFYGEVPQQNSLYVDYSTILVRKGNEEIQF
KFWVINHLHKHLTSQYYRTSILIMIYDITSRDSFTHIQYYYEDYVKKCNIKSIIALVGNK
KDLNEFRQVSFQEGQDLAKSLGVDFFEVSAFTGDKVKDLYDFLINQSFDTANFE