Identifiers and Description

Gene Model Identifier

TTHERM_00207260

Standard Name

RAB45 (RAB GTPase 45)

Aliases

PreTt13802 | 17.m00409

Description

RAB45 Ras family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_41009.1 0.0000000000005000841553255702
Description: hypothetical protein (178 aa)
SGD YLR262C 0.000000000010004361180063202
Description: YPT6 Rab family GTPase, Ras-like GTP binding protein involved in the secretory pathway, required for fusion of endosome-derived vesicles with the late Golgi, maturation of the vacuolar carboxypeptidase Y; has similarity to the human GTPase, Rab6
DictyBase DDB_G0270126 0.00000000007999955850159168
Description: rasY on chromosome: 1 position 4283626 to 4284369
WormBase WBGene00004269 0.00000000030007160092483236
Description: locus:rab-6.1 Ras-related protein Rab-6.1 status:Confirmed UniProt:P34213 protein_id:CAA77590.1
Oxytricha Contig22448.0.g39 0.00000000030007160092483236
Description: Ras family

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00207260(coding)
ATGGATAAACTGCTTAATCAATCTAATTAAATAAAAATATTACTTTTCGGAGATTATTTG
ACAGGAAAATCTTCCTTGCTAATAAGATACTTTTAGGATAAGTTCTATGACTATCCTGAT
TTATTTAGGAGAGAATTTTACTAAAAAATTTTGAAAAGCGGAAAAGATGAAATTAATTTA
TACATATCATATAATTGGTACTTAGATTTTAAGAATAGCAGCAATAATAAATATGTAGTT
TTATCTTTAATTGGAAATAAATGTGATTTGCAGGAAGAACATAGGTAGGTTTCTTATCAA
GAGGCTTAACAGCTTGCTTAATCCTTGGGAATGGTCTTCTTTGAAATTTCAGCTAAAACT
GGTTATCATGTAAACGAGTTGTTTGATTTTATAATTACTTAGGCTCAAAATATTGCTTGA


>TTHERM_00207260(gene)
ATGGATAAACTGCTTAATCAATCTAATTAAATAAAAATATTACTTTTCGGAGATTATTTG
ACAGGAAAATCTTCCTTGCTAATAAGATACTTTTAGGATAAGTTCTATGACTATCCTGAT
TTATTTAGGAGAGAATTTTACTAAAAAATTTTGAAAAGCGTAACATTATTCTTTAAATCA
AACATTTTTAAGTTTTTTTATTAGGGAAAAGATGAAATTAATTTATACATATGTGAATTT
GATTCAAATGAAAGAATGTACTACATAAAATAATTTTTTTATAGGACTTCTTCATTTATA
ATAATTTGTTATGATGTTACTAATAGATAAAGTTTTTAAAAAGCATATAATTGGTACTTA
GATTTTAAGAATAGCAGCAATAATAAATATGTAGTTTTATCTTTAATTGGAAATAAATGT
GATTTGCAGGAAGAACATAGGTAGGTTTCTTATCAAGAGGCTTAACAGCTTGCTTAATCC
TTGGGAATGGTCTTCTTTGAAATTTCAGCTAAAACTGGTTATCATGTAAACGAGTTGTTT
GATTTTATAATTACTTAGGCTCAAAATATTGCTTGA


>TTHERM_00207260(protein)
MDKLLNQSNQIKILLFGDYLTGKSSLLIRYFQDKFYDYPDLFRREFYQKILKSGKDEINL
YISYNWYLDFKNSSNNKYVVLSLIGNKCDLQEEHRQVSYQEAQQLAQSLGMVFFEISAKT
GYHVNELFDFIITQAQNIA