Identifiers and Description

Gene Model Identifier

TTHERM_00209270

Standard Name

RAB46 (RAB GTPase 46)

Aliases

PreTt13805 | 17.m00412

Description

RAB46 Ras family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Oxytricha Contig5831.0.g6 5.002276765025871e-34
Description: Ras family
Tetrahymena borealis EI9_01991.1 2.0003218023735366e-33
Description: hypothetical protein (178 aa)
DictyBase DDB_G0272138 9.000751454575209e-33
Description: rab2B on chromosome: 2 position 1483407 to 1484594
SGD YOR089C 3.00033207980219e-32
Description: VPS21 Rab family GTPase required for endocytic transport and for sorting of vacuolar hydrolases; localized in endocytic intermediates; detected in mitochondria; geranylgeranylation required for membrane association; mammalian Rab5 homolog
WormBase WBGene00004268 9.99967697349061e-30
Description: locus:rab-5 status:Partially_confirmed UniProt:P91857 protein_id:CAB04205.1
Stentor Coeruleus SteCoe_38174 0.00000000000003442477108469977
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00209270(coding)
ATGATTCATCAAACAGAGTAGTATAAAATTATGAAAGTAGCTTAAATAGGAGGTGGGTAT
ACAGGAAAGTCATCTTTATATTTGAGATATCTTTAAGGAGAGTTTATTGACAACCCTAAT
TATATTGGCGTTGAATTTTATACAAAAACTATTAAGATAGCAGAGGAACAAATTAAATTT
TAATTTTGGGATTGTCACTTGAACGAAAAAATCTATTCTTTATATCAAAATTATTTTAAA
TAATGTTCAATAGTTATGATATCTTATGACATTACTAATAGATACTCCTTTGATAGAGCG
CAATTATGGTGTAAAGATTACAATTAAAAAAAATTAAATAAAGTAGCTCTACTAGCTTTG
ATTGGAAATAAATGCGATTTAGAATAATAAAGGTAAGTTTCATATCAAGAGGGTAAACAT
ATTGCAAAGTCTTTAGGAATGCTATTCTTCGAAGTCTCCTCTAAAACAGGTTATTAAGTA
AATGAGCTGTTTGAAAGTTTAATAAGCTACGTGATCAATATTAATTGA


>TTHERM_00209270(gene)
ATGATTCATCAAACAGAGTAGTATAAAATTATGAAAGTAGCTTAAATAGGAGGTGGGTAT
ACAGGAAAGTCATCTTTATATTTGAGATATCTTTAAGGAGAGTTTATTGACAACCCTAAT
TATATTGGCGTTGAATTTTATACAAAAACTATTAAGATAGTAAAAATTAATTATTCTACA
AAATCTAAATAAAAATGTTTGATTTTATTTTTAATAGGCAGAGGAACAAATTAAATTTTA
ATTTTGGGATTGTCACTTGAACGAAAAAATCTATTCTTTATATCAAAATTATTTTAAATA
ATGTTCAATAGTTATGATATCTTATGACATTACTAATAGATACTCCTTTGATAGAGCGCA
ATTATGGTGTAAAGATTACAATTAAAAAAAATTAAATAAAGTAGCTCTACTAGCTTTGAT
TGGAAATAAATGCGATTTAGAATAATAAAGGTAAGTTTCATATCAAGAGGGTAAACATAT
TGCAAAGTCTTTAGGAATGCTATTCTTCGAAGTCTCCTCTAAAACAGGTTATTAAGTAAA
TGAGCTGTTTGAAAGTTTAATAAGCTACGTGATCAATATTAATTGA


>TTHERM_00209270(protein)
MIHQTEQYKIMKVAQIGGGYTGKSSLYLRYLQGEFIDNPNYIGVEFYTKTIKIAEEQIKF
QFWDCHLNEKIYSLYQNYFKQCSIVMISYDITNRYSFDRAQLWCKDYNQKKLNKVALLAL
IGNKCDLEQQRQVSYQEGKHIAKSLGMLFFEVSSKTGYQVNELFESLISYVININ