Identifiers and Description

Gene Model Identifier

TTHERM_00219050

Standard Name

MXR1 (peptide Methionine sulfoXide Reductase)

Aliases

PreTt22333 | 18.m00359 | 3701.m00118

Description

MXR1 peptide methionine sulfoxide reductase msrA; Methionine-S-sulfoxide reductase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01625 ) Peptide methionine sulfoxide reductase
  • ( TIGR00401 ) peptide-methionine (S)-S-oxide reductase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06682.1 2.9985100291019436e-113
Description: methionine-S-sulfoxide reductase (180 aa)
DictyBase DDB_G0276579 5.002382393859839e-46
Description: msrA on chromosome: 2 position 7002973 to 7003576
SGD YER042W 9.99723014177113e-33
Description: MXR1 Methionine-S-sulfoxide reductase, involved in the response to oxidative stress; protects iron-sulfur clusters from oxidative inactivation along with MXR2; involved in the regulation of lifespan
WormBase WBGene00018393 5.9971655715910366e-21
Description: locus:msra-1 status:Confirmed UniProt:O02089 protein_id:CCD63544.1
Stentor Coeruleus SteCoe_22343 0.000000000000001713908431542013
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219050(coding)
ATGTTAAAATACACCTAAAAATAAACTTTATAAATAATTTAATTAATTAAAAAATAATCG
AATTCTCAAATAATTAAAAGGTAAAGCAAGAAAGTAGAAAGTAAATAGATGTAAGCTCAT
AAAATAGCTACTATAGGAGGAGGATGCTTCTGGTGCACTGAAGCTGTTTTTAGAAGAGTC
ATAGGAGTCTCTGATGTAAAATCTGGTTATGCTGGTGGTAATGTTGATAACCCTACATAC
AAATAAATTTGTGCTGGAAATACTAATCATGCTGAAGTGATTCAATTACAATACAATCCA
AGTGTTATTTCTTATGATAATATTTTAAGAATATTTATGAATGTCCATGATCCAACTACT
AAAAATCGTTAGGGTGCTGATTCTGGAACATAATATAGATCAATTATTCTTTACAGTGAT
GAAGAATAAAAGAATATAGCTCATCAAATAATATCTGAAATCAATAACTCTAAGTTATAT
CCAAATCCAGTAGTAACAGAGGTTGTTCCATTAACTAAGTTCTATGAAGCAGAAAAAGAT
CATTAGAATTTCTACAACTTGAATTAAAACTACGGATATTGCAAAGCAGTAATAGATCCT
AAACTTAAGAAATTCTTAACAAAATACAAAGAATTTTCTTAGTGA


>TTHERM_00219050(gene)
ATGTTAAAATACACCTAAAAATAAACTTTATAAATAATTTAATTAATTAAAAAATAATCG
AATTCTCAAATAATTAAAAGGTAAAGCAAGAAAGTAGAAAGTAAATAGATGTAAGCTCAT
AAAATAGCTACTATAGGAGGAGGATGCTTCTGGTGCACTGAAGCTGTTTTTAGAAGAGTC
ATAGGAGTCTCTGATGTAAAATCTGGTTATGCTGGTGGTAATGTTGATAACCCTACATAC
AAATAAATTTGTGCTGGAAATACTAATCATGCTGAAGTGATTCAATTACAATACAATCCA
AGTGTTATTTCTTATGATAATATTTTAAGAATATTTATGAATGTCCATGATCCAACTACT
AAAAATCGTTAGGGTGCTGATTCTGGAACATAATATAGATCAATTATTCTTTACAGTGAT
GAAGAATAAAAGAATATAGCTCATCAAATAATATCTGAAATCAATAACTCTAAGTTATAT
CCAAATCCAGTAGTAACAGAGGTTGTTCCATTAACTAAGTTCTATGAAGCAGAAAAAGAT
CATTAGAATTTCTACAACTTGAATTAAAACTACGGATATTGCAAAGCAGTAATAGATCCT
AAACTTAAGAAATTCTTAACAAAATACAAAGAATTTTCTTAGTGA


>TTHERM_00219050(protein)
MLKYTQKQTLQIIQLIKKQSNSQIIKRQSKKVESKQMQAHKIATIGGGCFWCTEAVFRRV
IGVSDVKSGYAGGNVDNPTYKQICAGNTNHAEVIQLQYNPSVISYDNILRIFMNVHDPTT
KNRQGADSGTQYRSIILYSDEEQKNIAHQIISEINNSKLYPNPVVTEVVPLTKFYEAEKD
HQNFYNLNQNYGYCKAVIDPKLKKFLTKYKEFSQ