Identifiers and Description

Gene Model Identifier

TTHERM_00219200

Standard Name

NRK27 (NIMA-Related Kinase )

Aliases

PreTt22348 | 18.m00374 | 3701.m00133 | BrEt-1

Description

NRK27 bromodomain domain protein; NIMA-Related Kinase. Bromodomain and ET domain.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06701.1 9.997093137033517e-262
Description: hypothetical protein (1314 aa)
DictyBase DDB_G0271052 0.0000000008996637801615584
Description: snf2b on chromosome: 1 position 4502537 to 4512340
SGD YGR252W 0.0000000020002373268528243
Description: GCN5 Acetyltransferase, modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; catalytic subunit of the ADA and SAGA histone acetyltransferase complexes; founding member of the Gcn5p-related N-acetyltransferase superfamily; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10
  2. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00219200(coding)
ATGGACTAAAATCAAAATTAGTTTATAAATAATTAGAATCCTTAGTATTACTAGCAATTC
CATGCTGGAGGCAATGGATAAGAATTATAATAGTAAACAGGGTAGGCTCAATAAGGAACA
TAAAATTATTTTTAGTACATGGAGTAATAGCAGTAATAGCAATATCCTCAAATTCCATAA
TACCCTTAGCAAAACTCAACAGCGCCTTCAAACCCTTAGGTTTAATTGCCATAAAATTAA
TAAATGTATTAGTAGATGTATAATAGAAATTAGTAAATTAATGAAGCGGTTCCTTAGTAT
CAAAGAATATAAGGTGTGCAACCCACATTCTAAGGGATCCCCTAAAATTAAAATCAATAG
ATAGTAAATGCAATTCCATAATATCAAATTGGACAGCAAGTCCAACAACCTATAATGCAT
CATTAATCATAATAGCAAATACCAGTGTAAAACAAGAATTTGCCTCCTGGTCAATAATAA
AATCTATAATAGCAAATTCCAATAAATAAAGGTTAGCCTTAATCTACAATTAATAATATA
AATACCAGCAAACAATAAGCTAAAGCACCAAATCAAACAAATTAAATAGATAAATCTTTG
TTAACAATCTAAAAACAACCTAGTCAGTAGTAAAAAGGTATTTAGTAGCCTTATGTAAAT
TAATTTCAATAATAGAATTCTATTTCTCCTATTCCAAGCTAGATTAACCCTAATAATTTA
CAGGCAGGTAAGACTGCATAATTTTAAAAGCAGCAACCAGGCAGTTCTTAACCTCCTGTA
ATAAACTAAACTCCAGCTCAGTTGTAATAATAGTAAAGTATATAAAAATAAAATGCTCCT
TAAATATAGTAGCAAATGGGATAGAAATAGAACTTAGTTTAGCAGAAGCAATAACCCTAA
TTTAATTAATAAAATCTCCAACAAAAGTAGTAAGTTTAAAATTTAGGGCAACAATAAATG
CAAAACCCAGCTCAGCAGCAGTTTTAAAATAATTTTAAGCAGCTACCTAATTCTAATTCT
ATTGTGGGATAAGCTAATCCTCAAATTTAAACTAACTAATTTTAATCATAATAGCCACCT
CAATAATAGCCAAATCCATAAAAATAGACTATTTAACAACCATAGCATATAAATTAAAAT
AAAATGCAACAATAATAGTAATAATAATAAATAAATAAACCTATTGATTAGAGTTAAAAC
CAACTCGTAAAGCCTTAATAATTTAGTTCACAATAGCCCCTATAGTTATAGTAGTAAATT
CAACAAAATTAAAACCCTCAAAAGCAAATGCAATAACCTAGAACAGGTACTCAGTAATTA
GGTAAACCTTAACAACCAATATAAAAAATGCAAAATCCTGCACTAAATACTTAGTCAAGC
TAGCAATAACAATTCAATATTTAAAATCCATAACTGCAGTAAAGAATATAATCTTAGCAA
TAAACTTAAATAAAATAATAAGTTTAAGGTTCGAAGCCCTAGTTATAGCATCAAAATCAG
CAATTTTAAATGATGGGAAATTAAGCATAAGGAGGATAATAATAAATTTAGTAAAATTAT
CAATAATTTAGTTAAATACCTTAGTCTCAATAGCAATCTTAATCATAATAGCAATAAACC
TAACTTTAATAGTAGGGATAAATGGCAAGTTAAGGTCAGTAGCAACAAGAATAAGTCACT
ACATAAAGATAGAATAGGTTAGACTCTGGTGAAAATTTATTTTAATTTAGCTAGTTGAAT
AAAGCTCGTTAAGATTAAAAACCCTAATAAGGTTCAAACCAAAGAATGGATAATATTAAA
AAAGGATAGTATTTCGACATCAAATAATTTGATTCTGTTCTTGATAATAGAACGATGCCT
AAACTCTTTAATTTGACTCAAACTAAAGCTTATGAAATTAATTCAAACCTTCCTCCTGGT
TATTCTTTAGAACCTTTCTTTATCCACTAACTAAGATTTAACCCTAAGGTATATGGAGAA
GCAGCTAATGATTTTGGAGAGGCACCCTAGAAAAAAATAAAAACAGAAGAAAATCTCTTT
TTGCAATACAGTATTAGTTAGCTTGCTCCAAATGCTCCAATGAAGAGAGAATTAATATAG
CTTATGAATATAAAACCTTCTGTAAATCCTGTTTCAACCTTAATAACTCCAACAACAAAA
AAACCTTCAACATCAAATTAAAATTTAAACTAAGGATCAAGTTTGAACTCTACACCTTAA
AAATCATAAAATGATTTATCAAGGCAGAATTCTAAAATTTAAACCTCAAGCCAGCCCAGC
AGTATTGTATAAAGTACTCAGCAACAATAAATACCTAAAGAAAATAGCTAATAGTAATAA
TAATTATCTTAAAAAACTCCTTAATAAGCAGTTTAAAGCTAAAATCAACAATAGATAAAT
AGCTAGCCATCATAGTTGTAAAAGACATAAGAACAAAGCGTGAATTCTTAAATTTAAAGA
TAAAATCAATAAAACTAAGTTTAAAACTCTTTAAATTAAAACTAAAACCCTTTAAACAAA
AATTTACCTATAAAATAGTAAACACAACAACTTCCTTAACAAGCTAATTAAAATCCTGGT
ATAAATAAAAATATATAGTAACCTGGTTTTTCATAGAATTTATAGAAACCTTAAAATTAA
ATTCCTTAATAATAGATAAAAGTAAAAACTTAATAACCTGGGAATAATGTTTAAAATTAA
GCAGCTCCTCAACCGCCCAACGAAGGATAATAAAATACCTTATAAACAGTAAACAAAACA
CAAGGATAAGTATAAAATGAGATTCAAAATAAATAAATCTAGAACTAAAAGCCTGCTTAA
ACAAATTAAAATGTATAAATAAATTAGTCATAATAACAAAAAGTAAATTTAAATTAGTAG
TCATAAAATTTAAATAATAATATTTAAAATTAAAAAAATTAATAATAAAAGCCTCCATAA
ACATCTCAAAATCTAAATTAATCAAATTTAGTCAATAATTAAGAAAAAAATGTTTCAATT
TCATCTAGTTAATCTTCTTTGAAAATTTAATTACAATTACCTTAGTAGTAATAAAATACA
TAGCAATAGTAGTAATCAAATTAACAATAATAGTAAAATTAATAAATAAATTAAGCTAAT
AGATAAAACTTGCCACAAAATAGCAATACAATTTCCAGATAGTCTTCTTAGTAATCTCTG
TAATAATAAACTACAAATTAAAATAATTTAAACAATAATCAATAGTAATAAGGTTCTTAA
TAAAGTATGCCATAAAATTAAAAAATTCCTTCTTCAAACACATTATAATAGGCAAAAGAA
AAGAATTAATCAAGTGTAATTAAAATAAACTTAAATCTACCACAATAGTCTGAATAACCT
AGTTCTTAAAAGTTACCTGACACTTCTTAAAAATAATTAACATCCTCTAGTTCAAGTAAC
GTGTCTAGAGCTGGCTCATCTTAAAATATTAATATTCCAGGATAGCAGTTGCAAAATAAA
TTATAACAACCTGCTTAATCTTAATAAAATATTGCTCCTCCATTATCGCCTACACCATCG
TAGCCAATAGTAATTAGTACAATTATTGAAAATTTAGATATAGAAGACTCAAATAAATAA
ACTAATGCATAATAGTAGCAATCTAAATAACCTGCAATAGCAGAGAATAATAATAATAAT
GACTAATAAAACTTAAATTAAAAATCTTAGTAAGAATAGAATAAAGGGTAAAGTGTAAGC
GTTCCAAAGAAATCAGAATTACCACCTATTTTATTAAATAATATGTAATCTACATCTAAT
TAACCTTCTAAATAAAATATTCCAGTATTAGCATCACTTCCTCCCATGCTAAGACAACAA
ATGGAGAATTAAAATAAAAATGTTTAAGATCCTTGTAAAAAAGAAAATTAAGGATAAGAA
AGTAATATTCTATCAGAGCCTTTAAAAGAAACGAAAATGGAGATAGAAGAAAACATAGAA
AAATCTAATAAAATTTAAATTAGTTTTAGCAATAATTTAGTAAAAGAGGAAGAGATAAAT
TAATTGAATAAATCTTCTGACCAAATAATCTAAGATTAAAATATAAAGTCTCCTATATTA
CCTCCTTAATAACCAAGCCAGAGACCAAAATCTATTGATTTCCCAAGACCATCTTAACCC
AATTCTTAGCTTTTATTACAGGCTTCTAATTCTTCTAATATCCAAAATAATAAGGAACCA
ATAGTAAAGTCTGAAGAAACTAAAATATTTATAAAAATTCCTGATATTATGACTTCACAA
AGTCAATTAGCTTCTCCAACTAATCCAGAATCTGGTACTGCATTAGCTAGTAATAATATA
TCATTGAAATTTACAAATAAAATAGAAGAAGAAGTTTAAAACGAAGCGAGAACGAAAATA
GAAGAAAATATTAATGCAATGGAAATTGAATAACCTATTGAATAATTAGAATATCAAGAT
TAAAATATAGATGATAATTAGATGCAATTAAACACAGAGACTCCTTACTTTTAAACAGCT
GGATAACAATAAGCAAATTTAAATATAAAAGTAGAGCCCTTTAATGAATTAAACTAAATG
ATAAAATAAGAACACACTCAATCAGATTAAACTTATTTAGATCAAATACAGAAAGGGCCT
TAAGATAATTCCCTAATTATAACACTTCCAAACAACCCCATTCAACAAAAAATAGAAGCT
GATTCTAATTTAATGCCTATGAACCAACTTCCTGCTATGGTTTCATCAGCATCTTTAAAT
AACGATTTTATCAAAGAGAAAAAGAAGAAAATGGAAAAGAAAAATATATCACAAGAAGAT
TAAAAAGCTATGAGTGAAATAATTTAACGTCTTACAAAAAATAAAAATTCAGAACCATTC
AAAAAGTTATCCAGTCTTGCAAAGAATCCTGACTATCTAAAAATTATTAGAGAGCCTATG
GACTTGCAAACTGTGGAAACTAATATAAAGAAAAAATATTATAGTAATATTGACGAAATG
GCAGTTGATGTTAATAAAATATTTGCAAATGCCAAATTATACAACAAAGAAGACACTGAA
ATCTACAAAAAAGCTGTAGAACTAGAAGAATATTTTAAGAAGAAATACTAAAAAAGTCCT
CTGAGCAATGAGATAAATAACCTTTAAAAGAAAGTAGATAAACTTGGTAAAGAATTGAAA
GAGTATCACACTTACGGAGGAAGATTCTTCTACAGAGAAAATAAAAAAATATAAAAGTAA
GCTTTCATGGAGAGATCAATGTCTTTAGATGAAAAGACTTAGCTTGCTAAAAACATAAGA
AAGTTACCTAAGGAATATTGGATTGGTATATGGGAAATAATGACAGATAAGCAGTTTTGT
ATAGCTGATAAATAAAAAATTGAGTTTGATTTAGATACCACTACTCCAAAGTAGTGTAGG
AGGTTAGAAAGATATGTAAAAGCAAAGTTAAATTGTATTTAAAAGGCAAGAGAGAAAAAG
AACAAAAAGCTCGATAAAGCTTAAGGTAAATAGACAAGCGAGTATGTGGACCCTGCAAAA
CTAGAAAAACTAGATACCGATTCTTCTTATATTACAGAATCTGATGACTCTATGAAAGAC
CCAGATGAAGATGGAGGTGATTGA


>TTHERM_00219200(gene)
ATGGACTAAAATCAAAATTAGTTTATAAATAATTAGAATCCTTAGTATTACTAGCAATTC
CATGCTGGAGGCAATGGATAAGAATTATAATAGTAAACAGGGTAGGCTCAATAAGGAACA
TAAAATTATTTTTAGTACATGGAGTAATAGCAGTAATAGCAATATCCTCAAATTCCATAA
TACCCTTAGCAAAACTCAACAGCGCCTTCAAACCCTTAGGTTTAATTGCCATAAAATTAA
TAAATGTATTAGTAGATGTATAATAGAAATTAGTAAATTAATGAAGCGGTTCCTTAGTAT
CAAAGAATATAAGGTGTGCAACCCACATTCTAAGGGATCCCCTAAAATTAAAATCAATAG
ATAGTAAATGCAATTCCATAATATCAAATTGGACAGCAAGTCCAACAACCTATAATGCAT
CATTAATCATAATAGCAAATACCAGTGTAAAACAAGAATTTGCCTCCTGGTCAATAATAA
AATCTATAATAGCAAATTCCAATAAATAAAGGTTAGCCTTAATCTACAATTAATAATATA
AATACCAGCAAACAATAAGCTAAAGCACCAAATCAAACAAATTAAATAGATAAATCTTTG
TTAACAATCTAAAAACAACCTAGTCAGTAGTAAAAAGGTATTTAGTAGCCTTATGTAAAT
TAATTTCAATAATAGAATTCTATTTCTCCTATTCCAAGCTAGATTAACCCTAATAATTTA
CAGGCAGGTAAGACTGCATAATTTTAAAAGCAGCAACCAGGCAGTTCTTAACCTCCTGTA
ATAAACTAAACTCCAGCTCAGTTGTAATAATAGTAAAGTATATAAAAATAAAATGCTCCT
TAAATATAGTAGCAAATGGGATAGAAATAGAACTTAGTTTAGCAGAAGCAATAACCCTAA
TTTAATTAATAAAATCTCCAACAAAAGTAGTAAGTTTAAAATTTAGGGCAACAATAAATG
CAAAACCCAGCTCAGCAGCAGTTTTAAAATAATTTTAAGCAGCTACCTAATTCTAATTCT
ATTGTGGGATAAGCTAATCCTCAAATTTAAACTAACTAATTTTAATCATAATAGCCACCT
CAATAATAGCCAAATCCATAAAAATAGACTATTTAACAACCATAGCATATAAATTAAAAT
AAAATGCAACAATAATAGTAATAATAATAAATAAATAAACCTATTGATTAGAGTTAAAAC
CAACTCGTAAAGCCTTAATAATTTAGTTCACAATAGCCCCTATAGTTATAGTAGTAAATT
CAACAAAATTAAAACCCTCAAAAGCAAATGCAATAACCTAGAACAGGTACTCAGTAATTA
GGTAAACCTTAACAACCAATATAAAAAATGCAAAATCCTGCACTAAATACTTAGTCAAGC
TAGCAATAACAATTCAATATTTAAAATCCATAACTGCAGTAAAGAATATAATCTTAGCAA
TAAACTTAAATAAAATAATAAGTTTAAGGTTCGAAGCCCTAGTTATAGCATCAAAATCAG
CAATTTTAAATGATGGGAAATTAAGCATAAGGAGGATAATAATAAATTTAGTAAAATTAT
CAATAATTTAGTTAAATACCTTAGTCTCAATAGCAATCTTAATCATAATAGCAATAAACC
TAACTTTAATAGTAGGGATAAATGGCAAGTTAAGGTCAGTAGCAACAAGAATAAGTCACT
ACATAAAGATAGAATAGGTTAGACTCTGGTGAAAATTTATTTTAATTTAGCTAGTTGAAT
AAAGCTCGTTAAGATTAAAAACCCTAATAAGGTTCAAACCAAAGAATGGATAATATTAAA
AAAGGATAGTATTTCGACATCAAATAATTTGATTCTGTTCTTGATAATAGAACGATGCCT
AAACTCTTTAATTTGACTCAAACTAAAGCTTATGAAATTAATTCAAACCTTCCTCCTGGT
TATTCTTTAGAACCTTTCTTTATCCACTAACTAAGATTTAACCCTAAGGTATATGGAGAA
GCAGCTAATGATTTTGGAGAGGCACCCTAGAAAAAAATAAAAACAGAAGAAAATCTCTTT
TTGGTAAAACATTTTTATTTTGATCTATTATTTTTTATAAATATTAATCTTTTAACAACT
AAATAAATAAATAATACATAAAGCAATACAGTATTAGTTAGCTTGCTCCAAATGCTCCAA
TGAAGAGAGAATTAATATAGCTTATGAATATAAAACCTTCTGTAAATCCTGTTTCAACCT
TAATAACTCCAACAACAAAAAAACCTTCAACATCAAATTAAAATTTAAACTAAGGATCAA
GTTTGAACTCTACACCTTAAAAATCATAAAATGATTTATCAAGGCAGAATTCTAAAATTT
AAACCTCAAGCCAGCCCAGCAGTATTGTATAAAGTACTCAGCAACAATAAATACCTAAAG
AAAATAGCTAATAGTAATAATAATTATCTTAAAAAACTCCTTAATAAGCAGTTTAAAGCT
AAAATCAACAATAGATAAATAGCTAGCCATCATAGTTGTAAAAGACATAAGAACAAAGCG
TGAATTCTTAAATTTAAAGATAAAATCAATAAAACTAAGTTTAAAACTCTTTAAATTAAA
ACTAAAACCCTTTAAACAAAAATTTACCTATAAAATAGTAAACACAACAACTTCCTTAAC
AAGCTAATTAAAATCCTGGTATAAATAAAAATATATAGTAACCTGGTTTTTCATAGAATT
TATAGAAACCTTAAAATTAAATTCCTTAATAATAGATAAAAGTAAAAACTTAATAACCTG
GGAATAATGTTTAAAATTAAGCAGCTCCTCAACCGCCCAACGAAGGATAATAAAATACCT
TATAAACAGTAAACAAAACACAAGGATAAGTATAAAATGAGATTCAAAATAAATAAATCT
AGAACTAAAAGCCTGCTTAAACAAATTAAAATGTATAAATAAATTAGTCATAATAACAAA
AAGTAAATTTAAATTAGTAGTCATAAAATTTAAATAATAATATTTAAAATTAAAAAAATT
AATAATAAAAGCCTCCATAAACATCTCAAAATCTAAATTAATCAAATTTAGTCAATAATT
AAGAAAAAAATGTTTCAATTTCATCTAGTTAATCTTCTTTGAAAATTTAATTACAATTAC
CTTAGTAGTAATAAAATACATAGCAATAGTAGTAATCAAATTAACAATAATAGTAAAATT
AATAAATAAATTAAGCTAATAGATAAAACTTGCCACAAAATAGCAATACAATTTCCAGAT
AGTCTTCTTAGTAATCTCTGTAATAATAAACTACAAATTAAAATAATTTAAACAATAATC
AATAGTAATAAGGTTCTTAATAAAGTATGCCATAAAATTAAAAAATTCCTTCTTCAAACA
CATTATAATAGGCAAAAGAAAAGAATTAATCAAGTGTAATTAAAATAAACTTAAATCTAC
CACAATAGTCTGAATAACCTAGTTCTTAAAAGTTACCTGACACTTCTTAAAAATAATTAA
CATCCTCTAGTTCAAGTAACGTGTCTAGAGCTGGCTCATCTTAAAATATTAATATTCCAG
GATAGCAGTTGCAAAATAAATTATAACAACCTGCTTAATCTTAATAAAATATTGCTCCTC
CATTATCGCCTACACCATCGTAGCCAATAGTAATTAGTACAATTATTGAAAATTTAGATA
TAGAAGACTCAAATAAATAAACTAATGCATAATAGTAGCAATCTAAATAACCTGCAATAG
CAGAGAATAATAATAATAATGACTAATAAAACTTAAATTAAAAATCTTAGTAAGAATAGA
ATAAAGGGTAAAGTGTAAGCGTTCCAAAGAAATCAGAATTACCACCTATTTTATTAAATA
ATATGTAATCTACATCTAATTAACCTTCTAAATAAAATATTCCAGTATTAGCATCACTTC
CTCCCATGCTAAGACAACAAATGGAGAATTAAAATAAAAATGTTTAAGATCCTTGTAAAA
AAGAAAATTAAGGATAAGAAAGTAATATTCTATCAGAGCCTTTAAAAGAAACGAAAATGG
AGATAGAAGAAAACATAGAAAAATCTAATAAAATTTAAATTAGTTTTAGCAATAATTTAG
TAAAAGAGGAAGAGATAAATTAATTGAATAAATCTTCTGACCAAATAATCTAAGATTAAA
ATATAAAGTCTCCTATATTACCTCCTTAATAACCAAGCCAGAGACCAAAATCTATTGATT
TCCCAAGACCATCTTAACCCAATTCTTAGCTTTTATTACAGGCTTCTAATTCTTCTAATA
TCCAAAATAATAAGGAACCAATAGTAAAGTCTGAAGAAACTAAAATATTTATAAAAATTC
CTGATATTATGACTTCACAAAGTCAATTAGCTTCTCCAACTAATCCAGAATCTGGTACTG
CATTAGCTAGTAATAATATATCATTGAAATTTACAAATAAAATAGAAGAAGAAGTTTAAA
ACGAAGCGAGAACGAAAATAGAAGAAAATATTAATGCAATGGAAATTGAATAACCTATTG
AATAATTAGAATATCAAGATTAAAATATAGATGATAATTAGATGCAATTAAACACAGAGA
CTCCTTACTTTTAAACAGCTGGATAACAATAAGCAAATTTAAATATAAAAGTAGAGCCCT
TTAATGAATTAAACTAAATGATAAAATAAGAACACACTCAATCAGATTAAACTTATTTAG
ATCAAATACAGAAAGGGCCTTAAGATAATTCCCTAATTATAACACTTCCAAACAACCCCA
TTCAACAAAAAATAGAAGCTGATTCTAATTTAATGCCTATGAACCAACTTCCTGCTATGG
TTTCATCAGCATCTTTAAATAACGATTTTATCAAAGAGAAAAAGAAGAAAATGGAAAAGA
AAAATATATCACAAGAAGATTAAAAAGCTATGAGTGAAATAATTTAACGTCTTACAAAAA
ATAAAAATTCAGAACCATTCAAAAAGTTATCCAGTCTTGCAAAGAATCCTGACTATCTAA
AAATTATTAGAGAGCCTATGGACTTGCAAACTGTGGAAACTAATATAAAGAAAAAATATT
ATAGTAATATTGACGAAATGGCAGTTGATGTTAATAAAATATTTGCAAATGCCAAATTAT
ACAACAAAGAAGACACTGAAATCTACAAAAAAGCTGTAGAACTAGAAGAATATTTTAAGA
AGAAATACTAAAAAAGTCCTCTGAGCAATGAGATAAATAACCTTTAAAAGAAAGTAGATA
AACTTGGTAAAGAATTGAAAGAGTATCACACTTACGGAGGAAGATTCTTCTACAGAGAAA
ATAAAAAAATATAAAAGTAAGCTTTCATGGAGAGATCAATGTCTTTAGATGAAAAGACTT
AGCTTGCTAAAAACATAAGAAAGTTACCTAAGGAATATTGGATTGGTATATGGGAAATAA
TGACAGATAAGCAGTTTTGTATAGCTGATAAATAAAAAATTGAGTTTGATTTAGATACCA
CTACTCCAAAGTAGTGTAGGAGGTTAGAAAGATATGTAAAAGCAAAGTTAAATTGTATTT
AAAAGGCAAGAGAGAAAAAGAACAAAAAGCTCGATAAAGTAAATATTTTTTAACTATTTG
TCATCTTTATTTTGTATTTATTTCTTTAATTATTTAAATCAAAATAGGCTTAAGGTAAAT
AGACAAGCGAGTATGTGGACCCTGCAAAACTAGAAAAACTAGATACCGATTCTTCTTATA
TTACAGGTATTTTAGGAAATTAAGCTTTTTCTATTTTCTTAAAAATTCTATTTTTTTAAA
CAGAATCTGATGACTCTATGAAAGACCCAGATGAAGATGGAGGTGATTGA


>TTHERM_00219200(protein)
MDQNQNQFINNQNPQYYQQFHAGGNGQELQQQTGQAQQGTQNYFQYMEQQQQQQYPQIPQ
YPQQNSTAPSNPQVQLPQNQQMYQQMYNRNQQINEAVPQYQRIQGVQPTFQGIPQNQNQQ
IVNAIPQYQIGQQVQQPIMHHQSQQQIPVQNKNLPPGQQQNLQQQIPINKGQPQSTINNI
NTSKQQAKAPNQTNQIDKSLLTIQKQPSQQQKGIQQPYVNQFQQQNSISPIPSQINPNNL
QAGKTAQFQKQQPGSSQPPVINQTPAQLQQQQSIQKQNAPQIQQQMGQKQNLVQQKQQPQ
FNQQNLQQKQQVQNLGQQQMQNPAQQQFQNNFKQLPNSNSIVGQANPQIQTNQFQSQQPP
QQQPNPQKQTIQQPQHINQNKMQQQQQQQQINKPIDQSQNQLVKPQQFSSQQPLQLQQQI
QQNQNPQKQMQQPRTGTQQLGKPQQPIQKMQNPALNTQSSQQQQFNIQNPQLQQRIQSQQ
QTQIKQQVQGSKPQLQHQNQQFQMMGNQAQGGQQQIQQNYQQFSQIPQSQQQSQSQQQQT
QLQQQGQMASQGQQQQEQVTTQRQNRLDSGENLFQFSQLNKARQDQKPQQGSNQRMDNIK
KGQYFDIKQFDSVLDNRTMPKLFNLTQTKAYEINSNLPPGYSLEPFFIHQLRFNPKVYGE
AANDFGEAPQKKIKTEENLFLQYSISQLAPNAPMKRELIQLMNIKPSVNPVSTLITPTTK
KPSTSNQNLNQGSSLNSTPQKSQNDLSRQNSKIQTSSQPSSIVQSTQQQQIPKENSQQQQ
QLSQKTPQQAVQSQNQQQINSQPSQLQKTQEQSVNSQIQRQNQQNQVQNSLNQNQNPLNK
NLPIKQQTQQLPQQANQNPGINKNIQQPGFSQNLQKPQNQIPQQQIKVKTQQPGNNVQNQ
AAPQPPNEGQQNTLQTVNKTQGQVQNEIQNKQIQNQKPAQTNQNVQINQSQQQKVNLNQQ
SQNLNNNIQNQKNQQQKPPQTSQNLNQSNLVNNQEKNVSISSSQSSLKIQLQLPQQQQNT
QQQQQSNQQQQQNQQINQANRQNLPQNSNTISRQSSQQSLQQQTTNQNNLNNNQQQQGSQ
QSMPQNQKIPSSNTLQQAKEKNQSSVIKINLNLPQQSEQPSSQKLPDTSQKQLTSSSSSN
VSRAGSSQNINIPGQQLQNKLQQPAQSQQNIAPPLSPTPSQPIVISTIIENLDIEDSNKQ
TNAQQQQSKQPAIAENNNNNDQQNLNQKSQQEQNKGQSVSVPKKSELPPILLNNMQSTSN
QPSKQNIPVLASLPPMLRQQMENQNKNVQDPCKKENQGQESNILSEPLKETKMEIEENIE
KSNKIQISFSNNLVKEEEINQLNKSSDQIIQDQNIKSPILPPQQPSQRPKSIDFPRPSQP
NSQLLLQASNSSNIQNNKEPIVKSEETKIFIKIPDIMTSQSQLASPTNPESGTALASNNI
SLKFTNKIEEEVQNEARTKIEENINAMEIEQPIEQLEYQDQNIDDNQMQLNTETPYFQTA
GQQQANLNIKVEPFNELNQMIKQEHTQSDQTYLDQIQKGPQDNSLIITLPNNPIQQKIEA
DSNLMPMNQLPAMVSSASLNNDFIKEKKKKMEKKNISQEDQKAMSEIIQRLTKNKNSEPF
KKLSSLAKNPDYLKIIREPMDLQTVETNIKKKYYSNIDEMAVDVNKIFANAKLYNKEDTE
IYKKAVELEEYFKKKYQKSPLSNEINNLQKKVDKLGKELKEYHTYGGRFFYRENKKIQKQ
AFMERSMSLDEKTQLAKNIRKLPKEYWIGIWEIMTDKQFCIADKQKIEFDLDTTTPKQCR
RLERYVKAKLNCIQKAREKKNKKLDKAQGKQTSEYVDPAKLEKLDTDSSYITESDDSMKD
PDEDGGD