Identifiers and Description

Gene Model Identifier

TTHERM_00221140

Standard Name

ARS2 (Alanyl-tRNA Synthetase 2)

Aliases

PreTt22442 | 18.m00468 | 3701.m00225

Description

ARS2 alanine-tRNA ligase/alanyl-tRNA synthetase protein; Alanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_25370 0
Description: None
Tetrahymena borealis EI9_06795.1 9.997093137033517e-262
Description: alanyl-tRNA synthetase (976 aa)
Oxytricha Contig17366.0.g58 9.997093137033517e-262
Description: tRNA synthetases class II (A)
SGD YOR335C 7.998336109808381e-38
Description: ALA1 Cytoplasmic and mitochondrial alanyl-tRNA synthetase, required for protein synthesis; point mutation (cdc64-1 allele) causes cell cycle arrest at G1; lethality of null mutation is functionally complemented by human homolog
DictyBase DDB_G0277823 1.9994920269952867e-34
Description: alaS on chromosome: 3 position 919657 to 922497
WormBase WBGene00000197 4.000352986427571e-28
Description: locus:aars-2 Alanine--tRNA ligase, cytoplasmic status:Confirmed UniProt:O01541 protein_id:CCD70212.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00221140(coding)
ATGGAAAATTTTGAAGAAAAGGTAGAAGAAGCCACATTAGTTGCTGCCAAGACTCCTAAG
GAAATGAAGGCTATGTACAGACCTGAATTCTAAAAGAACCCTTAAAAGTATTATCCCACT
TAAGTTTTTGCTAAGTTTGGCTACTCTAGACACCAATGTCCTAAATGCCAAAACTTTTAT
TGGAGATTCTCTGAAAAGCAAGATACTTGTGGTGACTCTGCTTGTGTTGGCAAGTACACT
TTTATTGGTGAACCCACTGGTATTGGTAAGGAAGAAAAGTTGACTTATGATGGAGCTTGG
AAGAACTTCGAAAAGTCTTTCACTTCTGCAAGAAAACCTTGCACAGCTATCAAGAGATAT
CCCGTTGTTGCAAGATGGAGAAATGATGTTGACTTTGTTGCTGCTGGTATCTACTGCTTC
TAACCCTACTGCATGACTGGTGAATTATAACCCCCTGCTAATCCTTTGATCCAACCTCAA
TTCTGCGTTAGATTCAATGATTTAGATAACATTGGATTAACTGGTAGACATTACAGTGGT
TTCATTATGATTGGTATTCAATCTTTCTGCTATCCTGGAACTGAAGATAAGACTTTCTTC
AGTGAAGAATGTGTTGAATTCAACTTGAACTGGCTTATTGATGGTCTTAAGATTCCTAAG
GATGAAATTACTCTCATTGAAGATATCTGGTCTGGCGGTGGTAACTTAGGTTCTTGCGTT
GAATACTTCGTTAAGGGTCTCGAAGTTGGTAACATGGTCTTCACCATGTATAAGTATTAC
CCCGATGGTAAGCTTGAAGATTTAGAAATTAAAGTTATTGATGTTGGTATTGGTATGGAA
AGAATTCCTTGGTTAATTAATGGTACTCCTACTTCATATATGGATGTTTTCGATACTTCC
TACAAATATCTTTAAGAAAAGTTATAAGTAGAAACAAGCACTGAAATTTGGAAGTAGATT
GGTCCTTACACTTGCCATCTTAATGCTGATGAATCAGATGATATGGAAAAAACATGGTAA
ATGGTTGCTTCCAGCATTGGAAAAACTGTCTAAGAATGCAAGCAAGCTATCACTCCTGTT
AAGGATCTCTACATTGTCCTCGATCACACTAGAGCTGCTTTAGTTCTCATTTAAGATGGT
GCTTTACCTTCAAATACTGGTGGTGGTTCAAATATCAGAAATATCATCAGAAGAGTATTT
GCTATCATGAAGAAAAATGGATGGTGGGATAAGTTAGGTAAAACAAAGGAAGAATAAATG
AAGAACTTCTTGACATTGTTCGACATGCATCAATAAGATTTAGAAAAACTTTATGGTAAG
TTCCCTGAATACAAATCTTTCGGAAGCATTATTGAAATTGAATATGAAAAGTGGAGCAGC
ACTGATAAGGCTCAACAAAAGAAGATTGTAGACTCTTTCAATAAGAAGAAAGCTCTTACT
CTTAATGATTGGATCGTAGCTATCGAATCTTGGGGTTTGTCTCCTGATACTATCACAGAA
GTTACTGGACTTCCTTAACCTGATAACCTATACAATGAAATGGAATTAAGAAAGATGAAA
TTAACTAAAGCTCCTGAACAAATTCTTTACTAAACTGCCAACATTTAAGAAACTGTTCAT
CTCTTCTATGAACACCAAAATAAATTTGATTTTGAAGCTAAAATAGTAGAAATTTTCGCT
GATTATAAGAACGTTGAAAACCGTAACATCGTAATCCTCGATTAATCATGTTTCTATCCC
ACATCTGGTGGTTAACAAAATGACATTGGTGTCATGACCGTCGACGGTTAAAAGTATAAT
GTTGTTGATGTTATTAAGGTTGGTAAATGTGTTCTTCACATTTTAGATAGATCCCTCCCT
AATCCTGATAATTCCCATTACATTGGATAAAAAGTTCATGCTGTTGTTGATGAAAACAGA
AGAAAAATTCTTCGTAATCATCACACTTCTACTCATATTGTTTTTGCTGCTTGCAGACAA
GTTTTAGGTCCTCATGTCTGGTAAAATGGTGCTAAGAAAACTGTTGATATGGCTCACTTG
GACATAACTCATTATGCATCATTGACTGAAGAATAAGAAATGGAAATCGAAAAAATTGCT
AACACTATCGTTTTCAGTAGCAAGAATATCAACAAAGAATTTGTTAATAAAGCTGAAGCT
GAAAAAGAACATGGTTTCCGTCTTTATTAAGGTGGTGTTGTACCAGGTGATACTTTGAGA
GTAGTCAATATTGAAGGAACTGATGTTGAAGCCTGTTGTGGTACTCACTGCGATAACACC
TCTGAAGTTGGTATTATTAGAATTTTAAAGACTAACAGAATTTCAGATGGTATTATCAGA
TTATACTTTGTTGCTGGTGAAAGATCTCTCCAAAAACTCTCAACTTAAACTAAGGTCCTT
GTTGATTTACAAAATATCTTCAAGGTAAAAGAATCAGATCTTGTCAGCACTTCCTTAAAG
TTCTTTACTGAAAGAAATAAATTCATTGAACGTCACAAATCTGCAACTTAAAAGGTTTTA
AATCTTCAAATGGAATTATTCCTTGCTAAGGATAAATACAAAAACATCTTTGTAAAGTCT
ACTGAATCTGAAGCAACATTATATTTCTCTTTCATGGGCAACTTTATTAAAGCTCAAAAG
GATGCTGGTAAAGGTATAGTTTTTGTTGGAGAAGGAGAAAAAGGTTTTGTCTTTGGTTAA
TTCGGTAATAAATCTGACTTTGATCAAGAAAAGTTCTTAGCTTTATTATAAGAAGATAAT
CCAGGAGTCACATATAAAAAATGCTTAACTTCAATCACTGCTAACAAAGTTAAACTTGAC
AACGTTTTACAATTCTCTTTCAGTGGCAAAGTTAAATATGAAAAAGTAAAGAAAGATTTA
ATTACTCTTGGTCTTATTGAAGCAGATCTCTGA


>TTHERM_00221140(gene)
ATGGAAAATTTTGAAGAAAAGGTAGAAGAAGCCACATTAGTTGCTGCCAAGACTCCTAAG
GTATCCTTACAGATTTATATATTTATGAGAGATTAAAAAGATTAAACTTTAATCAGCATT
TTTGCTAATTTATATTTCATTTAAAAATAGGAAATGAAGGCTATGTACAGACCTGAATTC
TAAAAGAACCCTTAAAAGTATTATCCCACTTAAGTTTTTGCTAAGTTTGGCTACTCTAGA
CACCAATGTCCTAAATGCCAAAACTTTTATTGGAGATTCTCTGAAAAGCAAGATACTTGT
GGTGACTCTGCGTAATATATTATTCTTACTTTAATTATTATCCAATAATACTAAAAAACT
CTTTTAAAATACATTTATATCGAGGTATCTCCATATTATTATTAAAATTCGACATGTATT
TTATTTAAGGGAGAGCTATTTAATTAAGAAATAAATAATATTTTATTAAATAAATTTAAA
ACTGAATAGTATATTTAACCGAAGAAATTTTAACAAAGTATCAATAAAATAGCATTAATT
GTAAATTCATTTTTATATAAATATAGTTGTGTTGGCAAGTACACTTTTATTGGTGAACCC
ACTGGTATTGGTAAGGAAGAAAAGTTGACTTATGATGGAGCTTGGAAGAACTTCGAAAAG
TCTTTCACTTCTGCAAGAAAACCTTGCACAGCTATCAAGAGATATCCCGTTGTTGCAAGA
TGGAGGTAAAATTTATATTTATAGCTATTTTTTTAAACTTAGACATAATCATGTTTTATT
AATTTTGCTTATTGAAAATGTTTTATAAGCTGTTTTTTGTTAAAAAAAATTTAAAAAACG
AATTTTTCGAAGTTGTTAATCAAAGTTGGAATTATTATAAAATCAAGAATTAAAGTTTGG
CGGAATTCTTTTAAAAGAAACAAACGATAATAATTTATGTCTTTGATTTGTGTCTTAAAT
ATTGATAGATTATACTTTTTGCTAACAATAAAAAATATCTTTTTGATTTTAGAATTTTAA
TTAATTTAAATTAAAAAACAAAAGAAATGATGTTGACTTTGTTGCTGCTGGTATCTACTG
CTTCTAACCCTACTGCATGACTGGTGAATTATAACCCCCTGCTAATCCTTTGATCCAACC
TCAATTCTGCGTTAGATTCAATGATTTAGATAACATTGGATTAACTGGTAGACATTACAG
TGGTTTCATTATGATTGGTATTCAATCTTTCTGCTATCCTGGAACTGAAGATAAGACTTT
CTTCAGTGAAGAATGTGTTGAATTCAACTTGAACTGGCTTATTGATGGTCTTAAGATTCC
TAAGGATGAAATTACTCTCATTGAAGATATCTGGTCTGGCGGTGGTAACTTAGGTTCTTG
CGTTGAATACTTCGTTAAGGGTCTCGAAGTTGGTAACATGGTCTTCACCATGTATAAGTA
TTACCCCGATGGTAACATTTAGCATTTTATAATAATCAATATTTTTTAAATAATTTTTAT
TTACCAAACAGGTAAGCTTGAAGATTTAGAAATTAAAGTTATTGATGTTGGTATTGGTAT
GGAAAGAATTCCTTGGTTAATTAATGGTACTCCTACTTCATATATGGATGTTTTCGATAC
TTCCTACAAATATCTTTAAGAAAAGTTATAAGTAGAAACAAGCACTGAAATTTGGAAGTA
GATTGGTCCTTACACTTGCCATCTTAATGCTGATGAATCAGATGATATGGAAAAAACATG
GTAAATGGTTGCTTCCAGCATTGGAAAAACTGTCTAAGAATGCAAGCAAGCTATCACTCC
TGTTAAGGATCTCTACATTGTCCTCGATCACACTAGAGCTGCTTTAGTTCTCATTTAAGA
TGGTGCTGTAACTAAACAAAAAAATCTATAATTTAAAAAATATAATAATTTTTTCATAAA
ATAAATAAATAAAGTTACCTTCAAATACTGGTGGTGGTTCAAATATCAGAAATATCATCA
GAAGAGTATTTGCTATCATGAAGAAAAATGGATGGTGGGATAAGTTAGGTAAAACAAAGG
AAGAATAAATGAAGAACTTCTTGACATTGTTCGACATGCATCAATAAGATTTAGAAAAAC
TTTATGGTAAGTTCCCTGAATACAAATCTTTCGGAAGCATTATTGAAATTGAATATGAAA
AGTGGAGCAGCACTGATAAGGCTCAACAAAAGAAGATTGTAGACTCTTTCAATAAGAAGA
AAGCTCTTACTCTTAATGATTGGATCGTAGCTATCGAATCTTGGGGTTTGTCTCCTGATA
CTATCACAGAAGTTACTGGACTTCCTTAACCTGATAACCTATACAATGAAATGGAATTAA
GAAAGATGAAATTAACTAAAGCTCCTGAACAAATTCTTTACTAAACTGCCAACATTTAAG
AAACTGTTCATCTCTTCTATGAACACCAAAATAAATTTGATTTTGAAGCTAAAATAGTAG
AAATTTTCGCTGATTATAAGAACGTTGAAAACCGTAACATCGTAATCCTCGATTAATCAT
GTTTCTATCCCACATCTGGTGGTTAACAAAATGACATTGGTGTCATGACCGTCGACGGTT
AAAAGTATAATGTTGTTGATGTTATTAAGGTTGGTAAATGTGTTCTTCACATTTTAGATA
GATCCCTCCCTAATCCTGATAATTCCCATTACATTGGATAAAAAGTTCATGCTGTTGTTG
ATGAAAACAGAAGAAAAATTCTTCGTAATCATCACACTTCTACTCATATTGTTTTTGCTG
CTTGCAGACAAGTACTTATTTATTTATTTCAATAATAAAATTGAATTCCATTAAATTCAA
ATATCTGAATAATTTTTTTTATTTAGGTTTTAGGTCCTCATGTCTGGTAAAATGGTGCTA
AGAAAACTGTTGATATGGCTCACTTGGACATAACTCATTATGCATCATTGACTGAAGAAT
AAGAAATGGAAATCGAAAAAATTGCTAACACTATCGTTTTCAGTAGCAAGAATATCAACA
AAGAATTTGTTAATAAAGCTGAAGCTGAAAAAGAACATGGTTTCCGTCTTTATTAAGGTG
GTGTTGTACCAGGTGATACTTTGAGAGTAGTCAATATTGAAGGAACTGATGTTGAAGCCT
GTTGTGGTACTCACTGCGATAACACCTCTGAAGTTGGTATTATTAGAATTTTAAAGACTA
ACAGAATTTCAGATGGTATTATCAGATTATACTTTGTTGCTGGTGAAAGATCTCTCCAAA
AACTCTCAACTTAAACTAAGGTCCTTGTTGATTTACAAAATATCTTCAAGGTAAAAGAAT
CAGATCTTGTCAGCACTTCCTTAAAGTTCTTTACTGAAAGAAATAAATTCATTGAACGTC
ACAAATCTGCAACTTAAAAGGTTTTAAATCTTCAAATGGAATTATTCCTTGCTAAGGATA
AATACAAAAACATCTTTGTAAAGTCTACTGAATCTGAAGCAACATTATATTTCTCTTTCA
TGGGCAACTTTATTAAAGCTCAAAAGGTAATAATTTTATTTTTTTTATATTATTTTAAAT
AAATAATATTAAAATCTATTTAGGATGCTGGTAAAGGTATAGTTTTTGTTGGAGAAGGAG
AAAAAGGTTTTGTCTTTGGTTAATTCGGTAATAAATCTGACTTTGATCAAGAAAAGTTCT
TAGCTTTATTATAAGAAGATAATCCAGGAGTCACATATAAAAAATGCTTAACTTCAATCA
CTGCTAACAAAGTTAAAGTAATTTTAAATAAATATATTTTAATACAATAAGTTTTATTTT
TTTATTTAACAAAAAAGCTTGACAACGTTTTACAATTCTCTTTCAGTGGCAAAGTTAAAT
ATGAAAAAGTAAAGAAAGATTTAATTACTCTTGGTCTTATTGAAGCAGATCTCTGA


>TTHERM_00221140(protein)
MENFEEKVEEATLVAAKTPKEMKAMYRPEFQKNPQKYYPTQVFAKFGYSRHQCPKCQNFY
WRFSEKQDTCGDSACVGKYTFIGEPTGIGKEEKLTYDGAWKNFEKSFTSARKPCTAIKRY
PVVARWRNDVDFVAAGIYCFQPYCMTGELQPPANPLIQPQFCVRFNDLDNIGLTGRHYSG
FIMIGIQSFCYPGTEDKTFFSEECVEFNLNWLIDGLKIPKDEITLIEDIWSGGGNLGSCV
EYFVKGLEVGNMVFTMYKYYPDGKLEDLEIKVIDVGIGMERIPWLINGTPTSYMDVFDTS
YKYLQEKLQVETSTEIWKQIGPYTCHLNADESDDMEKTWQMVASSIGKTVQECKQAITPV
KDLYIVLDHTRAALVLIQDGALPSNTGGGSNIRNIIRRVFAIMKKNGWWDKLGKTKEEQM
KNFLTLFDMHQQDLEKLYGKFPEYKSFGSIIEIEYEKWSSTDKAQQKKIVDSFNKKKALT
LNDWIVAIESWGLSPDTITEVTGLPQPDNLYNEMELRKMKLTKAPEQILYQTANIQETVH
LFYEHQNKFDFEAKIVEIFADYKNVENRNIVILDQSCFYPTSGGQQNDIGVMTVDGQKYN
VVDVIKVGKCVLHILDRSLPNPDNSHYIGQKVHAVVDENRRKILRNHHTSTHIVFAACRQ
VLGPHVWQNGAKKTVDMAHLDITHYASLTEEQEMEIEKIANTIVFSSKNINKEFVNKAEA
EKEHGFRLYQGGVVPGDTLRVVNIEGTDVEACCGTHCDNTSEVGIIRILKTNRISDGIIR
LYFVAGERSLQKLSTQTKVLVDLQNIFKVKESDLVSTSLKFFTERNKFIERHKSATQKVL
NLQMELFLAKDKYKNIFVKSTESEATLYFSFMGNFIKAQKDAGKGIVFVGEGEKGFVFGQ
FGNKSDFDQEKFLALLQEDNPGVTYKKCLTSITANKVKLDNVLQFSFSGKVKYEKVKKDL
ITLGLIEADL