Identifiers and Description

Gene Model Identifier

TTHERM_00225720

Standard Name

RAB8B (RAB GTPase 8B)

Aliases

PreTt12482 | 19.m00274

Description

RAB8B small guanosine triphosphatase family Ras-related in brain (Rab) family protein; Rab VIII family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08923.1 4.0019235632881006e-109
Description: Ras family protein (205 aa)
Oxytricha Contig7494.0.g64 4.998338612125368e-60
Description: Ras family
DictyBase DDB_G0280043 5.997545490783615e-57
Description: rab8A on chromosome: 3 position 3266503 to 3267523
WormBase WBGene00004272 3.000458792073453e-56
Description: locus:rab-8 status:Confirmed UniProt:G5EFC1 protein_id:CCD68351.1
SGD YFL005W 2.000555387360374e-52
Description: SEC4 Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane
Stentor Coeruleus SteCoe_25160 7.984904245686979e-30
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00225720(coding)
ATGTAAAGTAAATAAGACTATGATACATTAATTAAGTTACTTATCCTTGGTGATTCAGGA
GTAGGAAAAACTTGCTTTTTAGTGAATTACTGCAAAAAATCTTTTACTAGAATACATCTA
CCTACAATTGGTATTGATTATGAGCATAAATATGAAGATGTAGATGGAAAGCATGTTAAA
CTTTAAATTTGGGATACAGCTGGCCAAGAGAGGTTTAAAACTATTACTTAAAATTACTAT
AAAGGCTCTATGGGTATTATACTTGCATATAGTGTAACAGATCCTAATACCTTTAAAAAT
ATAGCAGACTGGATGAAATAAATTAGCGAAAGAGCAGATCCATCTGTTAAAATAGTAATT
ATAGCTACTAAAATTGACATGAAAGATTAAAGAAAGGTCTCAACTTAAGAAGGAGAAGAG
TTAGCTCAAAAATATGGAGTAAAATTTTTTGAAACTTCTGCTTTGGAAGGAACAAACGTC
ATAGAAGCATTTAAATGTATTGCTAGTTAAGCACTCTAAACAATTTAAGCATCTTCTCCA
ATTAATAACTTTAAAATAATTCAAAAACCTGTAATTTAATCTAAAAAATAAGAAAAAGAT
GCAAAATGTTGCTGA


>TTHERM_00225720(gene)
ATGTAAAGTAAATAAGACTATGATACATTAATTAAGTTACTTATCCTTGGTGATTCAGGA
GTAGGAAAAACTTGCTTTTTAGTGAATTACTGCAAAAAATCTTTTACTAGAATACATCTA
CCTACAATTGGTATTGATTATGAGCATAAATATGAAGATGTAGATGGAAAGCATGTTAAA
CTTTAAATTTGGGATACAGCTGGCCAAGAGAGGTTTAAAACTATTACTTAAAATTACTAT
AAAGGCTCTATGGGTATTATACTTGCATATAGTGTAACAGATCCTAATACCTTTAAAAAT
ATAGCAGACTGGATGAAATAAATTAGCGAAAGAGCAGATCCATCTGTTAAAATAGTAATT
ATAGCTACTAAAATTGACATGAAAGATTAAAGAAAGGTCTCAACTTAAGAAGGAGAAGAG
TTAGCTCAAAAATATGGAGTAAAATTTTTTGAAACTTCTGCTTTGGAAGGAACAAACGTC
ATAGAAGCATTTAAATGTATTGCTAGTTAAGCACTCTAAACAATTTAAGCATCTTCTCCA
ATTAATAACTTTAAAATAATTCAAAAACCTGTAATTTAATCTAAAAAATAAGAAAAAGAT
GCAAAATGTTGCTGA


>TTHERM_00225720(protein)
MQSKQDYDTLIKLLILGDSGVGKTCFLVNYCKKSFTRIHLPTIGIDYEHKYEDVDGKHVK
LQIWDTAGQERFKTITQNYYKGSMGIILAYSVTDPNTFKNIADWMKQISERADPSVKIVI
IATKIDMKDQRKVSTQEGEELAQKYGVKFFETSALEGTNVIEAFKCIASQALQTIQASSP
INNFKIIQKPVIQSKKQEKDAKCC