Identifiers and Description

Gene Model Identifier

TTHERM_00225770

Standard Name

STF1 (Solute Transport Facilitator 1 )

Aliases

PreTt12487 | 19.m00279

Description

STF1 MFS transporter; major facilitator superfamily protein; Major facilitator, sugar transporter-like

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• A band (IEA) | GO:0031672
• alpha6-beta4 integrin-Shc-Grb2 complex (IEA) | GO:0070333
• cell outer membrane (IEA) | GO:0009279
• dense core granule (IEA) | GO:0031045
• dense core granule membrane (IEA) | GO:0032127
• EGFR-Grb2-Sos complex (IEA) | GO:0070620
• EmrE multidrug transporter complex (IEA) | GO:1990207
• external side of plasma membrane (IEA) | GO:0009897
• G-protein beta/gamma-subunit complex (IEA) | GO:0031680
• glutamate synthase complex (IEA) | GO:0031026
• H zone (IEA) | GO:0031673
• host cell (IEA) | GO:0043657
• ionotropic glutamate receptor complex (IEA) | GO:0008328
• medial cortex (IEA) | GO:0031097
• mitochondrial ATP-gated potassium channel complex (IEA) | GO:0062157
• motile primary cilium (IEA) | GO:0031512
• mRNA capping enzyme complex (IEA) | GO:0031533
• NADH dehydrogenase complex (plastoquinone) (IEA) | GO:0031675
• nucleolar chromatin (IEA) | GO:0030874
• obsolete chromosome segregation-directing complex (IEA) | GO:0043913
• obsolete ectoplasm (IEA) | GO:0043265
• obsolete ER proteasome core complex, alpha-subunit complex (IEA) | GO:0031605
• obsolete intrinsic component of synaptic vesicle membrane (IEA) | GO:0098563
• Parkin-FBXW7-Cul1 ubiquitin ligase complex (IEA) | GO:1990452
• PcG protein complex (IEA) | GO:0031519
• peptidase complex (IEA) | GO:1905368
• plastid mRNA editing complex (IEA) | GO:0031020
• platelet alpha granule (IEA) | GO:0031091
• TRAMP complex (IEA) | GO:0031499

Molecular Function

• 11-deoxycorticosterone binding (IEA) | GO:1903878
• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 3-hydroxybutyrate dehydrogenase activity (IEA) | GO:0003858
• 3-hydroxyisobutyrate dehydrogenase activity (IEA) | GO:0008442
• 3-hydroxyisobutyryl-CoA hydrolase activity (IEA) | GO:0003860
• 3-phosphoshikimate 1-carboxyvinyltransferase activity (IEA) | GO:0003866
• 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
• alpha-1B adrenergic receptor binding (IEA) | GO:0031692
• alpha-2A adrenergic receptor binding (IEA) | GO:0031694
• alpha-glucoside transmembrane transporter activity (IEA) | GO:0015151
• alpha-humulene synthase activity (IEA) | GO:0080017
• amino acid transmembrane transporter activity (IEA) | GO:0015171
• aromatase activity (IEA) | GO:0008402
• arsenate reductase (glutaredoxin) activity (IEA) | GO:0008794
• B2 bradykinin receptor binding (IEA) | GO:0031713
• benomyl transporter activity (IEA) | GO:0015242
• C5a anaphylatoxin chemotactic receptor binding (IEA) | GO:0031714
• calcium:monoatomic cation antiporter activity (IEA) | GO:0015368
• carboxymethylenebutenolidase activity (IEA) | GO:0008806
• coreceptor activity (IEA) | GO:0015026
• coreceptor, soluble ligand activity (IEA) | GO:0015027
• cyclase inhibitor activity (IEA) | GO:0010852
• Cys-tRNA(Pro) hydrolase activity (IEA) | GO:0043907
• cytochrome o ubiquinol oxidase activity (IEA) | GO:0008827
• delta5-delta2,4-dienoyl-CoA isomerase activity (IEA) | GO:0008416
• exopeptidase activity (IEA) | GO:0008238
• formylmethionine deformylase activity (IEA) | GO:0008463
• fucosyltransferase activity (IEA) | GO:0008417
• G protein-coupled serotonin receptor binding (IEA) | GO:0031821
• gamma-butyrobetaine dioxygenase activity (IEA) | GO:0008336
• gastrin-releasing peptide receptor binding (IEA) | GO:0031709
• glucuronate-2-sulfatase activity (IEA) | GO:0015024
• glycerol phosphate-importing ATPase activity (IEA) | GO:0015610
• heparin-sulfate lyase activity (IEA) | GO:0015021
• hydroxypyruvate reductase (NADH) activity (IEA) | GO:0008465
• Kdo2-lipid IVA acyltransferase activity (IEA) | GO:0008913
• lactaldehyde reductase activity (IEA) | GO:0008912
• leucyl-tRNA--protein transferase activity (IEA) | GO:0008914
• lipopolysaccharide heptosyltransferase activity (IEA) | GO:0008920
• lipopolysaccharide-1,5-galactosyltransferase activity (IEA) | GO:0035496
• lysine:proton symporter activity (IEA) | GO:0015493
• magnesium ion transmembrane transporter activity (IEA) | GO:0015095
• MAP kinase serine/threonine phosphatase activity (IEA) | GO:1990439
• mercury ion transmembrane transporter activity (IEA) | GO:0015097
• metalloexopeptidase activity (IEA) | GO:0008235
• methane monooxygenase [NAD(P)H] activity (IEA) | GO:0015049
• methotrexate transmembrane transporter activity (IEA) | GO:0015350
• methyltransferase activity (IEA) | GO:0008168
• microtubule severing ATPase activity (IEA) | GO:0008568
• mitochondrion targeting sequence binding (IEA) | GO:0030943
• myosin V binding (IEA) | GO:0031489
• obsolete amiloride transmembrane transporter activity (IEA) | GO:0015240
• obsolete caspase-10 activity (IEA) | GO:0004206
• obsolete cation:cation antiporter activity (IEA) | GO:0015491
• obsolete electron carrier, chlorophyll electron transport system (IEA) | GO:0015007
• obsolete exogenous peptide receptor activity (IEA) | GO:0008530
• obsolete GPI-anchored membrane-bound receptor (IEA) | GO:0015025
• obsolete hercynylselenocysteine lyase activity (selenoneine-forming) (IEA) | GO:1990412
• obsolete histone threonine kinase activity (IEA) | GO:0035184
• obsolete hydrogen-/sodium-translocating ATPase activity (IEA) | GO:0015442
• obsolete octanoyltransferase activity (IEA) | GO:0016415
• obsolete phosphatidylinositol 3-kinase, class I, catalyst activity (IEA) | GO:0015072
• obsolete sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity (IEA) | GO:0052591
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• obsolete type II protein secretor activity (IEA) | GO:0015447
• obsolete UV-sensitive opsin (IEA) | GO:0015064
• obsolete X-opioid receptor activity (IEA) | GO:0015051
• oligoxyloglucan reducing-end-specific cellobiohydrolase activity (IEA) | GO:0033945
• palmitoyl-(protein) hydrolase activity (IEA) | GO:0008474
• peptidyl-proline dioxygenase activity (IEA) | GO:0031543
• phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity (IEA) | GO:0016314
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• phosphofructokinase activity (IEA) | GO:0008443
• protein kinase C inhibitor activity (IEA) | GO:0008426
• protein-N-terminal asparagine amidohydrolase activity (IEA) | GO:0008418
• purinergic nucleotide receptor activity (IEA) | GO:0001614
• pyridoxal kinase activity (IEA) | GO:0008478
• pyrimidine nucleotide-sugar transmembrane transporter activity (IEA) | GO:0015165
• pyruvate, water dikinase activity (IEA) | GO:0008986
• receptor tyrosine kinase binding (IEA) | GO:0030971
• replication fork barrier binding (IEA) | GO:0031634
• ribose 1,5-bisphosphate isomerase activity (IEA) | GO:0043917
• Ser(Gly)-tRNA(Ala) hydrolase activity (IEA) | GO:0043908
• serine-type peptidase activity (IEA) | GO:0008236
• silver ion transmembrane transporter activity (IEA) | GO:0015080
• sterol 14-demethylase activity (IEA) | GO:0008398
• sulfite oxidase activity (IEA) | GO:0008482
• sulfuric ester hydrolase activity (IEA) | GO:0008484
• thiamine binding (IEA) | GO:0030975
• threonine-type peptidase activity (IEA) | GO:0070003
• tri-(coumaroyl or caffeoyl) spermidine meta-hydroxylase activity (IEA) | GO:0072533
• type 1B serotonin receptor binding (IEA) | GO:0031822
• type 4 neuropeptide Y receptor binding (IEA) | GO:0031844
• tyramine receptor activity (IEA) | GO:0008226
• UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity (IEA) | GO:0008489
• urease activity (IEA) | GO:0009039

Biological Process

• (R)-mevalonic acid biosynthetic process (IEA) | GO:1901737
• 1-(3,5-dichloro-2,6-dihydroxy-4-methoxyphenyl)hexan-1-one metabolic process (IEA) | GO:0031147
• 3-keto-sphinganine metabolic process (IEA) | GO:0006666
• acute-phase response (IEA) | GO:0006953
• aminoacyl-tRNA metabolism involved in translational fidelity (IEA) | GO:0106074
• angiotensin-mediated vasodilation involved in regulation of systemic arterial blood pressure (IEA) | GO:0002033
• asymmetric cell division (IEA) | GO:0008356
• axonemal microtubule depolymerization (IEA) | GO:0060404
• cAMP catabolic process (IEA) | GO:0006198
• canalicular bile acid transport (IEA) | GO:0015722
• capsanthin catabolic process (IEA) | GO:1901808
• CD4-positive, alpha-beta T cell differentiation involved in immune response (IEA) | GO:0002294
• cell adhesion involved in multi-species biofilm formation (IEA) | GO:0043710
• cell proliferation involved in mesonephros development (IEA) | GO:0061209
• cell rearrangement involved in Malpighian tubule morphogenesis (IEA) | GO:0061334
• cell wall modification involved in fruit ripening (IEA) | GO:0009829
• cellular response to diphenidol (IEA) | GO:1904561
• cellular response to dopamine (IEA) | GO:1903351
• cellular response to magnesium ion (IEA) | GO:0071286
• chloroplast fission (IEA) | GO:0010020
• chromatin assembly (IEA) | GO:0031497
• colanic acid biosynthetic process (IEA) | GO:0009242
• common myeloid progenitor cell proliferation (IEA) | GO:0035726
• creatine biosynthetic process (IEA) | GO:0006601
• cytochrome b6f complex assembly (IEA) | GO:0010190
• cytoplasmic actin-based contraction involved in forward cell motility (IEA) | GO:0060328
• de-etiolation (IEA) | GO:0009704
• deoxyribonucleoside monophosphate catabolic process (IEA) | GO:0009159
• deoxyribonucleotide biosynthetic process (IEA) | GO:0009263
• deoxyribonucleotide catabolic process (IEA) | GO:0009264
• detection of stimulus involved in Dma1-dependent checkpoint (IEA) | GO:1902419
• detection of stimulus involved in sensory perception of pain (IEA) | GO:0062149
• DNA recombinase mediator complex assembly (IEA) | GO:1903871
• dolichol-linked oligosaccharide biosynthetic process (IEA) | GO:0006488
• ent-pimara-8(14),15-diene biosynthetic process (IEA) | GO:1901541
• epithelium regeneration (IEA) | GO:1990399
• female germline ring canal stabilization (IEA) | GO:0008335
• fibroblast growth factor receptor signaling pathway (IEA) | GO:0008543
• fin regeneration (IEA) | GO:0031101
• flocculation via extracellular polymer (IEA) | GO:0032128
• forebrain development (IEA) | GO:0030900
• free ubiquitin chain depolymerization (IEA) | GO:0010995
• fucose metabolic process (IEA) | GO:0006004
• galactarate transmembrane transport (IEA) | GO:1902300
• galactose to glucose-1-phosphate metabolic process (IEA) | GO:0061612
• gastrulation involving germ band extension (IEA) | GO:0010004
• gene conversion at mating-type locus, DNA double-strand break processing (IEA) | GO:0031292
• generation of catalytic spliceosome for first transesterification step (IEA) | GO:0000349
• glycerol metabolic process (IEA) | GO:0006071
• glycolytic process from glycerol (IEA) | GO:0061613
• hair cycle process (IEA) | GO:0022405
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• hepaticobiliary system process (IEA) | GO:0061007
• hindbrain development (IEA) | GO:0030902
• homogentisate metabolic process (IEA) | GO:1901999
• immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
• induction of apoptosis by extracellular signals (IEA) | GO:0008624
• inflammatory response (IEA) | GO:0006954
• inhibitory killer cell immunoglobulin-like receptor signaling pathway (IEA) | GO:0002771
• innate immune response (sensu Viridiplantae) (IEA) | GO:0002226
• interleukin-12-mediated signaling pathway (IEA) | GO:0035722
• interleukin-15-mediated signaling pathway (IEA) | GO:0035723
• internal genitalia morphogenesis (IEA) | GO:0035260
• intracellular triglyceride homeostasis (IEA) | GO:0035356
• intraciliary retrograde transport (IEA) | GO:0035721
• iodide transmembrane transport (IEA) | GO:1904200
• killing of cells of another organism (IEA) | GO:0031640
• L-alanine transmembrane transport (IEA) | GO:1904557
• laminaritriose transport (IEA) | GO:2001097
• larval burrowing behavior (IEA) | GO:0035181
• leaf phyllotactic patterning (IEA) | GO:0060772
• leukocyte chemotaxis involved in inflammatory response (IEA) | GO:0002232
• loss of chromatin silencing (IEA) | GO:0006345
• lung basal cell differentiation (IEA) | GO:0060508
• maintenance of blood vessel diameter homeostasis by renin-angiotensin (IEA) | GO:0002034
• malate transmembrane transport (IEA) | GO:0071423
• maltoheptaose metabolic process (IEA) | GO:2001122
• maltose import across plasma membrane (IEA) | GO:0106081
• mitotic actomyosin contractile ring assembly actin filament organization (IEA) | GO:1903479
• mitotic cytokinetic cell separation (IEA) | GO:1902409
• mitotic nuclear division (IEA) | GO:0007067
• multicellular organism development (IEA) | GO:0007275
• myoblast fate commitment in trunk (IEA) | GO:0014715
• myosin II filament organization (IEA) | GO:0031038
• N-acetylglucosamine catabolic process (IEA) | GO:0006046
• N-terminal protein amino acid acetylation (IEA) | GO:0006474
• negative regulation of all-trans-retinyl-ester hydrolase, 11-cis retinol forming activity (IEA) | GO:0062003
• negative regulation of calcium ion import across plasma membrane (IEA) | GO:1905949
• negative regulation of cellular glucuronidation (IEA) | GO:2001030
• negative regulation of chemokine-mediated signaling pathway (IEA) | GO:0070100
• negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
• negative regulation of DNA recombinase mediator complex assembly (IEA) | GO:1903873
• negative regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001033
• negative regulation of heat generation (IEA) | GO:0031651
• negative regulation of heterochromatin formation (IEA) | GO:0031452
• negative regulation of interleukin-4-mediated signaling pathway (IEA) | GO:1902215
• negative regulation of L-glutamine biosynthetic process (IEA) | GO:0062133
• negative regulation of muscle atrophy (IEA) | GO:0014736
• negative regulation of nervous system process (IEA) | GO:0031645
• negative regulation of neuronal signal transduction (IEA) | GO:1902848
• negative regulation of oligopeptide transport (IEA) | GO:2000877
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• negative regulation of postsynaptic membrane organization (IEA) | GO:1901627
• negative regulation of programmed necrotic cell death (IEA) | GO:0062099
• negative regulation of renal water transport (IEA) | GO:2001152
• negative regulation of response to drug (IEA) | GO:2001024
• negative regulation of signal transduction (IEA) | GO:0009968
• negative regulation of somitomeric trunk muscle development (IEA) | GO:0014710
• negative regulation of sprouting angiogenesis (IEA) | GO:1903671
• negative regulation of tumor necrosis factor-mediated signaling pathway (IEA) | GO:0010804
• neuroendocrine cell differentiation involved in prostate gland acinus development (IEA) | GO:0060531
• neutral lipid metabolic process (IEA) | GO:0006638
• nitrate transmembrane transport (IEA) | GO:0015706
• nucleotide biosynthetic process (IEA) | GO:0009165
• obsolete actin filament bundle convergence involved in mitotic contractile ring assembly (IEA) | GO:1903478
• obsolete activation of MAPK activity (IEA) | GO:0000187
• obsolete activation of pro-apoptotic gene products (IEA) | GO:0008633
• obsolete actomyosin contractile ring disassembly (IEA) | GO:1902621
• obsolete changes to DNA methylation involved in embryo development (IEA) | GO:1901538
• obsolete chromatin disassembly (IEA) | GO:0031498
• obsolete ethanol oxidation (IEA) | GO:0006069
• obsolete histone succinylation (IEA) | GO:0106077
• obsolete induction by virus of host cell-cell fusion (IEA) | GO:0006948
• obsolete MAPK cascade involved in ascospore formation (IEA) | GO:1903695
• obsolete microRNA biosynthetic process (IEA) | GO:0010195
• obsolete microRNA metabolic process (IEA) | GO:0010194
• obsolete mitotic chromosome decondensation (IEA) | GO:0007083
• obsolete modification by organism of membrane in other organism involved in symbiotic interaction (IEA) | GO:0052332
• obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
• obsolete multi-organism cellular localization (IEA) | GO:1902581
• obsolete negative regulation by organism of symbiont ethylene-mediated defense response (IEA) | GO:0052484
• obsolete negative regulation by organism of symbiont T-cell mediated immune response (IEA) | GO:0052474
• obsolete negative regulation of methylenetetrahydrofolate reductase (NAD(P)H) activity (IEA) | GO:1903869
• obsolete negative regulation of transcription during mitotic cell cycle (IEA) | GO:0007068
• obsolete nuclear membrane vesicle binding to chromatin (IEA) | GO:0007085
• obsolete positive regulation of histone H3-K27 methylation (IEA) | GO:0061087
• obsolete positive regulation of induction of conjugation with cellular fusion by negative regulation of transcription from RNA polymerase II promoter by pheromones (IEA) | GO:1902353
• obsolete positive regulation of methylenetetrahydrofolate reductase (NAD(P)H) activity (IEA) | GO:1903870
• obsolete protein localization to Mmi1 nuclear focus complex (IEA) | GO:1902666
• obsolete regulation of L-leucine import (IEA) | GO:0060357
• obsolete regulation of M/G1 transition of mitotic cell cycle (IEA) | GO:0060630
• obsolete regulation of MAPK export from nucleus (IEA) | GO:0071701
• obsolete regulation of mRNA cleavage (IEA) | GO:0031437
• obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
• obsolete regulation of peptidyl-serine dephosphorylation (IEA) | GO:1902308
• obsolete reproduction (IEA) | GO:0000003
• obsolete response to lipoic acid (IEA) | GO:1990479
• obsolete response to long exposure to lithium ion (IEA) | GO:0043460
• obsolete sigma virus replication (IEA) | GO:0008167
• obsolete transcription, RNA-dependent (IEA) | GO:0006410
• obsolete viral replication (IEA) | GO:0008166
• octanol metabolic process (IEA) | GO:0006070
• ommochrome biosynthetic process (IEA) | GO:0006727
• organic anion transport (IEA) | GO:0015711
• parathion metabolic process (IEA) | GO:0018952
• peptidoglycan catabolic process (IEA) | GO:0009253
• peptidoglycan turnover (IEA) | GO:0009254
• peptidyl-tyrosine sulfation (IEA) | GO:0006478
• phagocytosis (IEA) | GO:0006909
• phagocytosis, engulfment (IEA) | GO:0006911
• phosphatidyl-N-monomethylethanolamine biosynthetic process (IEA) | GO:0006647
• phyllotactic patterning (IEA) | GO:0060771
• plant-type cell wall modification (IEA) | GO:0009827
• plasminogen activation (IEA) | GO:0031639
• polyisoprenoid biosynthetic process (IEA) | GO:0009241
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of actin binding (IEA) | GO:1904618
• positive regulation of ATF6-mediated unfolded protein response (IEA) | GO:1903893
• positive regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001034
• positive regulation of establishment of RNA localization to telomere (IEA) | GO:1904912
• positive regulation of glutamate secretion (IEA) | GO:0014049
• positive regulation of hematopoietic stem cell differentiation (IEA) | GO:1902038
• positive regulation of interleukin-4-mediated signaling pathway (IEA) | GO:1902216
• positive regulation of macrophage derived foam cell differentiation (IEA) | GO:0010744
• positive regulation of mating type switching (IEA) | GO:0031496
• positive regulation of membrane tubulation (IEA) | GO:1903527
• positive regulation of oligopeptide transport (IEA) | GO:2000878
• positive regulation of plant epidermal cell differentiation (IEA) | GO:1903890
• positive regulation of potassium ion export (IEA) | GO:1902304
• positive regulation of renal water transport (IEA) | GO:2001153
• positive regulation of siRNA processing (IEA) | GO:1903705
• positive regulation of turning behavior involved in mating (IEA) | GO:0061095
• positive regulation of type II interferon-mediated signaling pathway (IEA) | GO:0060335
• pre-replicative complex assembly involved in cell cycle DNA replication (IEA) | GO:1902299
• preblastoderm mitotic cell cycle (IEA) | GO:0035185
• primary cell septum biogenesis (IEA) | GO:0031671
• primitive palate development (IEA) | GO:0062010
• programmed cell death (IEA) | GO:0012501
• pronephric glomerulus morphogenesis (IEA) | GO:0035775
• pronuclear fusion (IEA) | GO:0007344
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• protein dephosphorylation (IEA) | GO:0006470
• protein K27-linked deubiquitination (IEA) | GO:1990167
• protein localization to meiotic spindle midzone (IEA) | GO:1903096
• protein localization to old growing cell tip (IEA) | GO:1903858
• pyrimidine deoxyribonucleotide biosynthetic process (IEA) | GO:0009221
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of 3'-UTR-mediated mRNA stabilization (IEA) | GO:1905868
• regulation of antisense RNA transcription (IEA) | GO:0060194
• regulation of brain-derived neurotrophic factor receptor signaling pathway (IEA) | GO:0031548
• regulation of cap-independent translational initiation (IEA) | GO:1903677
• regulation of cell adhesion involved in sprouting angiogenesis (IEA) | GO:0106088
• regulation of cellular defense response (IEA) | GO:0010185
• regulation of cellular glucuronidation (IEA) | GO:2001029
• regulation of cellular response to hepatocyte growth factor stimulus (IEA) | GO:2001112
• regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of dendrite extension (IEA) | GO:1903859
• regulation of DNA recombinase mediator complex assembly (IEA) | GO:1903872
• regulation of dolichol biosynthetic process (IEA) | GO:0010794
• regulation of frizzled signaling pathway (IEA) | GO:0008590
• regulation of germ cell proliferation (IEA) | GO:1905936
• regulation of glucosylceramide catabolic process (IEA) | GO:2000752
• regulation of gonad development (IEA) | GO:1905939
• regulation of heat generation (IEA) | GO:0031650
• regulation of interferon-beta secretion (IEA) | GO:0035547
• regulation of methylenetetrahydrofolate reductase (NAD(P)H) activity (IEA) | GO:1903868
• regulation of microglial cell migration (IEA) | GO:1904139
• regulation of mitotic DNA damage checkpoint (IEA) | GO:1904289
• regulation of mRNA 3'-UTR binding (IEA) | GO:1903837
• regulation of muscle hyperplasia (IEA) | GO:0014738
• regulation of penile erection (IEA) | GO:0060405
• regulation of PERK-mediated unfolded protein response (IEA) | GO:1903897
• regulation of phosphatidate phosphatase activity (IEA) | GO:1903730
• regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001245
• regulation of protein localization to cell division site (IEA) | GO:1901900
• regulation of protein maturation by peptide bond cleavage (IEA) | GO:0010953
• regulation of respiratory gaseous exchange by nervous system process (IEA) | GO:0002087
• regulation of response to type II interferon (IEA) | GO:0060330
• regulation of satellite cell activation involved in skeletal muscle regeneration (IEA) | GO:0014717
• regulation of skeletal muscle contraction by chemo-mechanical energy conversion (IEA) | GO:0014862
• regulation of sporocarp development involved in sexual reproduction (IEA) | GO:1902058
• regulation of stress response to copper ion (IEA) | GO:1903853
• regulation of vitamin A metabolic process (IEA) | GO:1901738
• renal tubule morphogenesis (IEA) | GO:0061333
• response to auditory stimulus (IEA) | GO:0010996
• response to chitin (IEA) | GO:0010200
• response to curcumin (IEA) | GO:1904643
• response to ketamine (IEA) | GO:1901986
• response to rest involved in regulation of muscle adaptation (IEA) | GO:0014893
• response to sodium dodecyl sulfate (IEA) | GO:0072706
• response to temperature stimulus (IEA) | GO:0009266
• rRNA pseudouridine synthesis (IEA) | GO:0031118
• secondary palate development (IEA) | GO:0062009
• single-organism intracellular transport (IEA) | GO:1902582
• skeletal muscle satellite stem cell asymmetric division involved in skeletal muscle regeneration (IEA) | GO:0014716
• smooth muscle atrophy (IEA) | GO:0014890
• smooth muscle hyperplasia (IEA) | GO:0014806
• snRNA export from nucleus (IEA) | GO:0006408
• sodium-independent prostaglandin transport (IEA) | GO:0071720
• steroid hormone receptor complex assembly (IEA) | GO:0006463
• sterol metabolic process (IEA) | GO:0016125
• stress-activated protein kinase signaling cascade (IEA) | GO:0031098
• striated muscle atrophy (IEA) | GO:0014891
• succinate transmembrane transport (IEA) | GO:0071422
• symbiont-mediated suppression of host innate immune response (IEA) | GO:0052170
• syncytium formation (IEA) | GO:0006949
• T-helper cell lineage commitment (IEA) | GO:0002295
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• tertiary branching involved in mammary gland duct morphogenesis (IEA) | GO:0060748
• toll-like receptor signaling pathway (IEA) | GO:0002224
• U6 2'-O-snRNA methylation (IEA) | GO:1990438
• vesicle cargo loading (IEA) | GO:0035459
• xanthophyll biosynthetic process (IEA) | GO:0016123
• zymogen activation (IEA) | GO:0031638

Domains

• ( PF00083 ) Sugar (and other) transporter

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No.	Gene Name(s)	Paragraph Text
2231	STF1	Solute Transport Facilitator 1 (STF1) is a protein from the major facilitator superfamily (MFS), one of the largest families of membrane transports known, found in archaea, bacteria, and eukaryotes. This protein is predicted to have a MFS1 domain (E-value 1e-08), and is likely to transport small solutes through the membrane through either uniport, symport, or antiport. Paragraph by: Lisette Espinosa and Charles McGregor (undergraduates), Keck Science Department, Claremont McKenna College

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00225770(coding)
ATGAGTTAAAATAATAATGTATAAGACAAAGGTGATGATGATAACGTCTCCGATTTAGAA
AAAAAGACTTTAGATGAAAATTTAGATATGGATTAATGTTTGGAATATGTGAATCCAAAA
GGAAAATACTAGCTCATATTGTTTTCAATTTTACTTTTATAAGGCATAGTAGGATCATTT
GTATTTGTTGGAGGTCCTTATTTTTTTTAAGATCCTATTTTTATTTGTTAAGATGGATCA
ACATGTAGTTAAGAAGATGCTTGTAAATAAGGAAACTACTCAATTTCCGATAGCAGTAAC
CATACTCTAACTCTCCAGTTTGATCTATATTGCGATAGATAGTATCTCAAAAATTTAAGT
CTTAGCTTTATTTTTATTGGTTCTCTTTGTGGGACGTTCTTTTTTAGTTTTCTGAGTGAT
TTAAAAGGAAGAAAATTGCCTATGATAATATCATGGGCTTTTAGCGTTTTGGGTATTGGA
ATATTAGCTTTTTCTCAAAATTATGCTATGATTTTTGTAGGTTAGTTTTTAGGTGGATTC
GGAATCTATCCAACGAGCACTTTGGCTTTTATCGTTATGAGTGAATAATCAACAGGTAAT
TTTAGAAAGGTAGCTACAGGATATTTATTATTAGGCTATACACTTAGTGAGGGATCAATC
AATTTGCTAGGTTTTCTTTTTAACAACGATTGGAAGATTTTAATTAGATATTGGTTATTT
ATTCCTTCCATTATTTTGTGGTTTCCACTCTTTTATTTAATTGAAAGCCCAAGATTTTAT
CTAAATAAAGATAAGGAAAAAGTCTTAGATTGTTTGAACAAAATTGGAGCTAGAAACACT
AAAAAATCATACTAAGCAGCTCCGTTGCAGTTAACTAAAGAATAAATTAATTTCCATAAG
TACTCACTAATTAAGAAGAAAGAAGTTTATTCTTATTTAACCCTCTTTAAGTATAAATCA
ACTAGGTGGATTACAATTGCTTGCTCTATATAAAAGTTTTTAATGATATTTGTTAATTAT
GGTACTTAGTTCTCTCTATCTGATTTTGGCTTTAATATTTACATTAATGCAACCATAGGA
TTCTTGGCTGAGATGGTTTGCTTTGGATTCTTAGTCAAAGTTTTGAATACCTTCAAAAGA
AAACCTTCTGCTTTGTTCTTTTAGATTTTGAGTAGCATTTTCTGCTTGCTATTTATTGCT
TTTCCTATCCCAGACTCCTGCAAAAATAGCAGCTGCTATCAGAAATATGTATAAATCTTG
CTCTTTTTACTTTCTAAAATGTCGATTAACTCCTACTTTGTTGTCATAAGTACTTATTTC
CCTGAATTATACCCAACTTCTGTCAGGAGCTTAGGTGTAGGTTTTATCAGAGCAACTGGA
ATCTCAGGAAGTATTCTATCTTCCTTCGCCATAAGCTGGAGTAAAGAATTGGGAATATCT
CCTCTTGTTTCTTTTGGTATTATTGGTAGTTTTGGAATTATTTTTGGATTCTATCTACCT
GAAACATAAAATCAACCATTACAAGATGAAATAATAGAAATTAAGCATCAGAAAAATTCT
CTATTAGAAGTAGATGCATATTAAGCAGTTTCAAAAATAAGTGATACTTATAACAATTAA
CTTAGTAATTAAAGTGATGATTGA

>TTHERM_00225770(gene)
ATTCTTTTACAAAATAATTAAATTGAATGATATAAATTGTGTAAATAAAGAAGAATTTAC
TTAATATGATTGATTAATAAAATATTAAATTTATACAGAATGAGTTAAAATAATAATGTA
TAAGACAAAGGTGATGATGATAACGTCTCCGATTTAGAAAAAAAGACTTTAGATGAAAAT
TTAGATATGGATTAATGTTTGGAATATGTGAATCCAAAAGGAAAATACTAGCTCATATTG
TTTTCAATTTTACTTTTATAAGGCATAGTAGGATCATTTGTATTTGTTGGAGGTCCTTAT
TTTTTTTAAGATCCTATTTTTATTTGTTAAGATGGATCAACATGTAGTTAAGAAGATGCT
TGTAAATAAGGAAACTACTCAATTTCCGATAGCAGTAACCATACTCTAACTCTCCAGTTT
GATCTATATTGCGATAGATAGTATCTCAAAAATTTAAGTCTTAGCTTTATTTTTATTGGT
TCTCTTTGTGGGACGTTCTTTTTTAGTTTTCTGAGTGATTTAAAAGGAAGAAAATTGCCT
ATGATAATATCATGGGCTTTTAGCGTTTTGGGTATTGGAATATTAGCTTTTTCTCAAAAT
TATGCTATGATTTTTGTAGGTTAGTTTTTAGGTGGATTCGGAATCTATCCAACGAGCACT
TTGGCTTTTATCGTTATGAGTGAATAATCAACAGGTAATTTTAGAAAGGTAGCTACAGGA
TATTTATTATTAGGCTATACACTTAGTGAGGGATCAATCAATTTGCTAGGTTTTCTTTTT
AACAACGATTGGAAGATTTTAATTAGATATTGGTTATTTATTCCTTCCATTATTTTGTGG
TTTCCACTCTTTTATTTAATTGAAAGCCCAAGATTTTATCTAAATAAAGATAAGGAAAAA
GTCTTAGATTGTTTGAACAAAATTGGAGCTAGAAACACTAAAAAATCATACTAAGCAGCT
CCGTTGCAGTTAACTAAAGAATAAATTAATTTCCATAAGTACTCACTAATTAAGAAGAAA
GAAGTTTATTCTTATTTAACCCTCTTTAAGTATAAATCAACTAGGTGGATTACAATTGCT
TGCTCTATATAAAAGTTTTTAATGATATTTGTTAATTATGGTACTTAGTTCTCTCTATCT
GATTTTGGCTTTAATATTTACATTAATGCAACCATAGGATTCTTGGCTGAGATGGTTTGC
TTTGGATTCTTAGTCAAAGTTTTGAATACCTTCAAAAGAAAACCTTCTGCTTTGTTCTTT
TAGATTTTGAGTAGCATTTTCTGCTTGCTATTTATTGCTTTTCCTATCCCAGACTCCTGC
AAAAATAGCAGCTGCTATCAGAAATATGTATAAATCTTGCTCTTTTTACTTTCTAAAATG
TCGATTAACTCCTACTTTGTTGTCATAAGTACTTATTTCCCTGAATTATACCCAACTTCT
GTCAGGAGCTTAGGTGTAGGTTTTATCAGAGCAACTGGAATCTCAGGAAGTATTCTATCT
TCCTTCGCCATAAGCTGGAGTAAAGAATTGGGAATATCTCCTCTTGTTTCTTTTGGTATT
ATTGGTAGTTTTGGAATTATTTTTGGATTCTATCTACCTGAAACATAAAATCAACCATTA
CAAGATGAAATAATAGAAATTAAGCATCAGAAAAATTCTCTATTAGAAGTAGATGCATAT
TAAGCAGTTTCAAAAATAAGTGATACTTATAACAATTAACTTAGTAATTAAAGTGATGAT
TGATTTCTTAAAATATTTTAAGTTTGTATATTTTTAAAAAAAATATAATATATATGTTAT
TTATTTTAAATATAAAAAATAATCAAATATTATTTATTTTTAATGTATATATACTATTAG
TATTATCTTCAAGTATTTTAA

>TTHERM_00225770(protein)
MSQNNNVQDKGDDDNVSDLEKKTLDENLDMDQCLEYVNPKGKYQLILFSILLLQGIVGSF
VFVGGPYFFQDPIFICQDGSTCSQEDACKQGNYSISDSSNHTLTLQFDLYCDRQYLKNLS
LSFIFIGSLCGTFFFSFLSDLKGRKLPMIISWAFSVLGIGILAFSQNYAMIFVGQFLGGF
GIYPTSTLAFIVMSEQSTGNFRKVATGYLLLGYTLSEGSINLLGFLFNNDWKILIRYWLF
IPSIILWFPLFYLIESPRFYLNKDKEKVLDCLNKIGARNTKKSYQAAPLQLTKEQINFHK
YSLIKKKEVYSYLTLFKYKSTRWITIACSIQKFLMIFVNYGTQFSLSDFGFNIYINATIG
FLAEMVCFGFLVKVLNTFKRKPSALFFQILSSIFCLLFIAFPIPDSCKNSSCYQKYVQIL
LFLLSKMSINSYFVVISTYFPELYPTSVRSLGVGFIRATGISGSILSSFAISWSKELGIS
PLVSFGIIGSFGIIFGFYLPETQNQPLQDEIIEIKHQKNSLLEVDAYQAVSKISDTYNNQ
LSNQSDD