Identifiers and Description

Gene Model Identifier

TTHERM_00227040

Standard Name

FKB1 (FK506 Binding protein 1)

Aliases

PreTt12514 | 19.m00306

Description

FKB1 peptidyl-prolyl cis-trans isomerase; Putative 12-kD FK506 binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05520.1 7.000324531217758e-70
Description: FKBP12 (111 aa)
SGD YNL135C 1.999683289470905e-41
Description: FPR1 Peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function
Oxytricha Contig18830.0.g95 4.9998290395614495e-40
Description: FKBP-type peptidyl-prolyl cis-trans isomerase
WormBase WBGene00001427 3.9990760533890984e-36
Description: locus:fkb-2 Peptidyl-prolyl cis-trans isomerase status:Confirmed UniProt:Q9U2Q8 protein_id:CAA22330.1
DictyBase DDB_G0275227 3.000842737734004e-34
Description: DDB_G0275227 on chromosome: 2 position 4935740 to 4936447
Stentor Coeruleus SteCoe_24113 4.248354255291589e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00227040(coding)
ATGTCTGAATTATAAGTAGTTACCAAGAAACCAGGTGATGGTAAGACTTATCCTAAAAAG
GGATAAACCGTCACAGTCCACTACGTCGGTACCTTCACTGATGGTAGAAAGTTTGACTCT
TCTAGAGACAGAAAGGAACCTTTCTAATTCAACATCGGAAGCGGTTAAGTTATTAAAGGT
TGGGATGAAGGTGTCGCTAGAATGTCCCTCGGTGAAGTTGCTGTTATCACTTGTCCTTAC
TAATACGCTTATGGTGAAAAGGGTTATCCTGGTGTCATCCCTCCTAAGGCCACCTTAGTT
TTCGAAGTTGAACTCCTCGGTATGTAATGA


>TTHERM_00227040(gene)
ATGTCTGAATTATAAGTAGTTACCAAGAAACCAGGTGATGGTAAGACTTATCCTAAAAAG
GGATAAACCGTCACAGTCCACTACGTCGGTACCTTCACTGATGGTAGAAAGTTTGACTCT
TCTAGAGACAGAAAGGAACCTTTCTAATTCAACATCGGAAGCGGTTAAGTTATTAAAGGT
TGGGATGAAGGTGTCGCTAGAATGTCCCTCGGTGAAGTTGCTGTTATCACTTGTCCTTAC
TAATACGCTTATGGTGAAAAGGGTTATCCTGGTGTCATCCCTCCTAAGGCCACCTTAGTT
TTCGAAGTTGAACTCCTCGGTATGTAATGA


>TTHERM_00227040(protein)
MSELQVVTKKPGDGKTYPKKGQTVTVHYVGTFTDGRKFDSSRDRKEPFQFNIGSGQVIKG
WDEGVARMSLGEVAVITCPYQYAYGEKGYPGVIPPKATLVFEVELLGMQ