Identifiers and Description

Gene Model Identifier

TTHERM_00227050

Standard Name

PPI22 (peptidylprolyl isomerase 22)

Aliases

PreTt12515 | 19.m00307

Description

PPI22 peptidyl-prolyl cis-trans isomerase; FKBP12 binding Protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05519.1 8.003355238965419e-63
Description: FKBP12 binding protein (113 aa)
Oxytricha Contig18830.0.g95 3.998777993244535e-41
Description: FKBP-type peptidyl-prolyl cis-trans isomerase
SGD YNL135C 8.003017249547689e-39
Description: FPR1 Peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function
WormBase WBGene00001427 4.00073564232477e-35
Description: locus:fkb-2 Peptidyl-prolyl cis-trans isomerase status:Confirmed UniProt:Q9U2Q8 protein_id:CAA22330.1
DictyBase DDB_G0275227 6.000802209040518e-34
Description: DDB_G0275227 on chromosome: 2 position 4935740 to 4936447
Stentor Coeruleus SteCoe_24113 3.1391327920480296e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00227050(coding)
ATGATATAGATAAAGTATTTATTTTAGTAAAAAAAAAGGATTTTCAAGGAGCAGATTATA
TACCAAATTTTTAGAATCTTAAAAATAGCTTTAAAACGTACTGTTAACGTCAAAAAAAAT
TAATCAATTTATCAAAAATATAAATCACTTTTTCAAAATTTTAAAAGTAAACAATAAATA
TCAAAAAACATGTCTGAATTGTCTGTAGTTACCAAATAGCCTGGTGATGGCAAAACCTAT
CCTAAAAAGGGTTAAAATGTTACTGTACATTATGTAGGTACATTCCCTGATGGCAAAAAA
TTTGATTCCTCAAGAGACAAGAACAGACCCTTCAAGTTCGTCTTGGGTGCAGGTTAAGTT
ATTAAAGGCTGGGATGAAGGTGTAGCCAGAATGAGTCTCGGTGAAATCGCTGTTATCACT
TGTCCTTACTAATATGCATATGGTGAACAAGGATATCCCGGAGTTATTCCTCCTAAAGCC
ACCTTGGTTTTCGAAGTTGAATTATTAGGATTGAATTGA


>TTHERM_00227050(gene)
ATGATATAGATAAAGTATTTATTTTAGTAAAAAAAAAGGATTTTCAAGGAGCAGATTATA
TACCAAATTTTTAGAATCTTAAAAATAGCTTTAAAACGTACTGTTAACGTCAAAAAAAAT
TAATCAATTTATCAAAAATATAAATCACTTTTTCAAAATTTTAAAAGTAAACAATAAATA
TCAAAAAACATGTCTGAATTGTCTGTAGTTACCAAATAGCCTGGTGATGGCAAAACCTAT
CCTAAAAAGGGTTAAAATGTTACTGTACATTATGTAGGTACATTCCCTGATGGCAAAAAA
TTTGATTCCTCAAGAGACAAGAACAGACCCTTCAAGTTCGTCTTGGGTGCAGGTTAAGTT
ATTAAAGGCTGGGATGAAGGTGTAGCCAGAATGAGTCTCGGTGAAATCGCTGTTATCACT
TGTCCTTACTAATATGCATATGGTGAACAAGGATATCCCGGAGTTATTCCTCCTAAAGCC
ACCTTGGTTTTCGAAGTTGAATTATTAGGATTGAATTGA


>TTHERM_00227050(protein)
MIQIKYLFQQKKRIFKEQIIYQIFRILKIALKRTVNVKKNQSIYQKYKSLFQNFKSKQQI
SKNMSELSVVTKQPGDGKTYPKKGQNVTVHYVGTFPDGKKFDSSRDKNRPFKFVLGAGQV
IKGWDEGVARMSLGEIAVITCPYQYAYGEQGYPGVIPPKATLVFEVELLGLN