Identifiers and Description

Gene Model Identifier

TTHERM_00227060

Standard Name

PPI21 (peptidylprolyl isomerase 21)

Aliases

PreTt12516 | 19.m00308

Description

PPI21 peptidyl-prolyl cis-trans isomerase; FKBP12 binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05518.1 8.997777707990486e-82
Description: FKBP12 binding protein (134 aa)
Oxytricha Contig18830.0.g95 4.001118334825066e-42
Description: FKBP-type peptidyl-prolyl cis-trans isomerase
SGD YNL135C 1.0002335610448659e-38
Description: FPR1 Peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function
DictyBase DDB_G0275227 1.0000633497921574e-36
Description: DDB_G0275227 on chromosome: 2 position 4935740 to 4936447
WormBase WBGene00001427 4.000054831110256e-33
Description: locus:fkb-2 Peptidyl-prolyl cis-trans isomerase status:Confirmed UniProt:Q9U2Q8 protein_id:CAA22330.1
Stentor Coeruleus SteCoe_24113 4.248354255291589e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00227060(coding)
ATGTATGATATTTTGATTAAATTGAAGACGTAGATTAGATAGTACGATAAAAAAATTATA
TATATTATTCAGAAAATCATTCAAAATTTAAATAAAATGAATAAATTATTATAAACAGCT
ATTACAAGATCAACTTTCTTCGCAAAGCAATCCCGTTTTTCAACTACCCCTGATTAGTTC
AGTGTTGTAACTAAGAAGGCTGGTGATAATACCAACTACCCAAAAAATGGTGACAAGGTA
ACTGTTCATTACGTAGGAACTTTTACAGATGGCAAAAAGTTTGATTCTTCTAGAGATAGA
AATTAACCTTTCTAATTTATTTTAGGTGCTGGTTAAGTTATTAGAGGATGGGATGAAGGA
GTAGGTAAATTAAGTCTTGGTGAAGTTGCCACCATTACTTGCCCTTATTAATATGCTTAT
GGCGAAAGAGGTTATCCTGGTGTTATCCCTCCTAAGGCCACTCTCCTTTTCGAAGTCGAA
CTTCTTAGCTTCAAGAAATGA


>TTHERM_00227060(gene)
ATGTATGATATTTTGATTAAATTGAAGACGTAGATTAGATAGTACGATAAAAAAATTATA
TATATTATTCAGAAAATCATTCAAAATTTAAATAAAATGAATAAATTATTATAAACAGCT
ATTACAAGATCAACTTTCTTCGCAAAGCAATCCCGTTTTTCAACTACCCCTGATTAGTTC
AGTGTTGTAACTAAGAAGGCTGGTGATAATACCAACTACCCAAAAAATGGTGACAAGGTA
ACTGTTCATTACGTAGGAACTTTTACAGATGGCAAAAAGTTTGATTCTTCTAGAGATAGA
AATTAACCTTTCTAATTTATTTTAGGTGCTGGTTAAGTTATTAGAGGATGGGATGAAGGA
GTAGGTAAATTAAGTCTTGGTGAAGTTGCCACCATTACTTGCCCTTATTAATATGCTTAT
GGCGAAAGAGGTTATCCTGGTGTTATCCCTCCTAAGGCCACTCTCCTTTTCGAAGTCGAA
CTTCTTAGCTTCAAGAAATGA


>TTHERM_00227060(protein)
MYDILIKLKTQIRQYDKKIIYIIQKIIQNLNKMNKLLQTAITRSTFFAKQSRFSTTPDQF
SVVTKKAGDNTNYPKNGDKVTVHYVGTFTDGKKFDSSRDRNQPFQFILGAGQVIRGWDEG
VGKLSLGEVATITCPYQYAYGERGYPGVIPPKATLLFEVELLSFKK