Identifiers and Description

Gene Model Identifier

TTHERM_00242580

Standard Name

THD9 (Tetrahymena Histone Deacetylase 9)

Aliases

PreTt18995 | 20.m00459 | 3706.m00223

Description

THD9 SIR2 family transcriptional regulator; Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00205 ) Thiamine pyrophosphate enzyme, central domain
  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07749.1 9.997093137033517e-262
Description: transcriptional regulator, Sir2 family protein (446 aa)
Oxytricha Contig19063.0.g74 4.001202823045957e-54
Description: Sir2 family
Stentor Coeruleus SteCoe_10597 2.9374821117108028e-30
Description: None
DictyBase DDB_G0283917 8.999890565246037e-26
Description: sir2A on chromosome: 4 position 1272110 to 1273864
WormBase WBGene00004803 2.999534586690157e-23
Description: locus:sir-2.4 NAD-dependent protein deacetylase sir-2.4 status:Confirmed UniProt:Q95Q89 protein_id:CCD61225.1
SGD YOL068C 3.001003044337619e-17
Description: HST1 NAD(+)-dependent histone deacetylase; essential subunit of the Sum1p/Rfm1p/Hst1p complex required for ORC-dependent silencing and mitotic repression; non-essential subunit of the Set3C deacetylase complex; involved in telomere maintenance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00242580(coding)
ATGAAAATTAATAAATTCATTAAAAAAGCGTTCTCTACTATTTAGGAAAGCGAATATAGC
AAATACTTTTCTAAAAACTCTGTATACCATTAGAAAGATAAGTTCTTGTTTAATCCTAGA
CTTAAAGATACTTAAGAGCATTAAGATTCACCAGAATAAATAGATACCAAAGTAAATCAG
CTTATAGAATTACTTTAAAAAAGTAAGAATGCTGTGATATTAACTGGAGCTGGAGTTAGT
ACAGCTTCAGGTATACCTGATTATAGAAGTGGTGCAAATACTATTTTAAAAACAGGACCT
GGTAAGTGGGAATTAGAGGAAAACAAAAAAAAATTTTTGGAAGAAAAAGGTAAGCCATAA
ATAATATTAGCAATAAATGCATTCCCTTCTCCAACTCATATGGCAATTTCAAAACTATAT
AAAGAGAATTTGATAAAATCAGTAATTACTTAAAATGTTGATAACTTGCATCATTAAAGT
GGTATTCCAAGGAAAGATATTCATGAGCTGCATGGGAATATTATTTCAGAGAGATGTGAA
AAGTGTAATTATGTCCATTATAGAGATTTTTATACTCGTTTAAAACATTTGAAATGGGGA
GATCCACATAACACTGGAAGAATTTGCTAAAAAAATGGATGTGATGGATAATTGCACGAC
ACTTTGGTATTTTTTGGAGAATCAGTATTACAAAATATAAAATAATCAGCATAAGAATAA
ATTGAAAGTGCAGATTTGTGCATAGTGGTAGGAACGAGCTTGACAGTTTAATCTGCAGCT
AGGTTAGTTTGGATTTCTTAGTAAAGAGGAATTCCTATAGTAATAATAAATCTACAAAAA
ACAAGCTATGATTCGAAGGCACTTAAAATTAATGGTTTATGTGAACCTATCTTTGATTTG
ATTCTTAAAAAACTTAATTTCTAGCCCGATAAATTTACAGTTTAAAGGGATATTATATTG
AGATTTTAGAAAACTGGGTTTTGCAGCTTTGATTTGTTTGCTGACTGTGAAAGTTTTGAT
GGAAGCCATTTGAGTGCTATTAAATAATTAGAAATTTGGTATAGAAAAGAAAATGGAAAT
TAATTATATAAAAGCTTTGAAGGTCATCCATACTATTTTTAAGCTGAAGATTCATTTAAC
ATAGATCAAATTAAATTAAATTTTTTTTCTCACCATAAAGAAAAGAGTCACTTTATTTAT
GACTAGGAGGTATTATAAAATGGATAGCTATTTAGTATGAGCTCTCCAGGGTCATTAATT
TTCCTTACATCTAAATTAACATATGAATTTTAAGATTAAAAAGATGAATGGATTGCTTAA
CATAAAATTGAAAGCTACAAATGA


>TTHERM_00242580(gene)
ATGAAAATTAATAAATTCATTAAAAAAGCGTTCTCTACTATTTAGGAAAGCGAATATAGC
AAATACTTTTCTAAAAACTCTGTATACCATTAGAAAGATAAGTTCTTGTTTAATCCTAGA
CTTAAAGATACTTAAGAGCATTAAGATTCACCAGAATAAATAGATACCAAAGTAAATCAG
CTTATAGAATTACTTTAAAAAAGTAAGAATGCTGTGATATTAACTGGAGCTGGAGTTAGT
ACAGCTTCAGGTATACCTGATTATAGAAGTGGTGCAAATACTATTTTAAAAACAGGACCT
GGTAAGTGGGAATTAGAGGAAAACAAAAAAAAATTTTTGGAAGAAAAAGGTAAGCCATAA
ATAATATTAGCAATAAATGCATTCCCTTCTCCAACTCATATGGCAATTTCAAAACTATAT
AAAGAGAATTTGATAAAATCAGTAATTACTTAAAATGTTGATAACTTGCATCATTAAAGT
GGTATTCCAAGGAAAGATATTCATGAGCTGCATGGGAATATTATTTCAGAGAGATGTGAA
AAGTGTAATTATGTCCATTATAGAGATTTTTATACTCGTTTAAAACATTTGAAATGGGGA
GATCCACATAACACTGGAAGAATTTGCTAAAAAAATGGATGTGATGGATAATTGCACGAC
ACTTTGGTATTTTTTGGAGAATCAGTATTACAAAATATAAAATAATCAGTAAAATTAATA
TGAGAATTAGGGATTTAAATATACTTTTATTTAATTAATTAATAAACTCTACTTATAAAG
TAGAAAAAAGACTATACCTCCTTTATTTAATTTAATTTTTTTATTAATATTAAAAGGCAT
AAGAATAAATTGAAAGTGCAGATTTGTGCATAGTGGTAGGAACGAGCTTGACAGTTTAAT
CTGCAGCTAGGTTAGTTTGGATTTCTTAGTAAAGAGGAATTCCTATAGTAATAATAAATC
TACAAAAAACAAGCTATGATTCGAAGGCACTTAAAATTAATGGTTTATGTGAACCTATCT
TTGATTTGATTCTTAAAAAACTTAATTTCTAGCCCGATAAATTTACAGTTTAAAGGTAAA
TATTTGAATTTATTTTTTAAAATGTAAAGCTACTTGTGTCAAATTAATATAATTTCGCTA
AAAGAAATATTTAATCTTACTCATTAAATTTTTATTTAAAAAAAAGCTTTTTTACATTTT
GCATTAAATTTTTTTAAATACATATTTTTGTTTTTTAATATGAAATTAAGGGATATTATA
TTGAGATTTTAGAAAACTGGGTTTTGCAGCTTTGATTTGTTTGCTGACTGTGAAAGTTTT
GATGGAAGCCATTTGAGTGCTATTAAATAATTAGAAATTTGGTATAGAAAAGAAAATGGA
AATTAATTATATAAAAGCTTTGAAGGTCATCCATACTATTTTTAAGCTGAAGATTCATTT
AACATAGATCAAATTAAATTAAATTTTTTTTCTCACCATAAAGAAAAGAGTCACTTTATT
TATGACTAGGAGGTATTATAAAATGGATAGCTATTTAGTATGAGCTCTCCAGGGTCATTA
ATTTTCCTTACATCTAAATTAACATATGAATTTTAAGATTAAAAAGATGAATGGATTGCT
TAACATAAAATTGAAAGCTACAAATGA


>TTHERM_00242580(protein)
MKINKFIKKAFSTIQESEYSKYFSKNSVYHQKDKFLFNPRLKDTQEHQDSPEQIDTKVNQ
LIELLQKSKNAVILTGAGVSTASGIPDYRSGANTILKTGPGKWELEENKKKFLEEKGKPQ
IILAINAFPSPTHMAISKLYKENLIKSVITQNVDNLHHQSGIPRKDIHELHGNIISERCE
KCNYVHYRDFYTRLKHLKWGDPHNTGRICQKNGCDGQLHDTLVFFGESVLQNIKQSAQEQ
IESADLCIVVGTSLTVQSAARLVWISQQRGIPIVIINLQKTSYDSKALKINGLCEPIFDL
ILKKLNFQPDKFTVQRDIILRFQKTGFCSFDLFADCESFDGSHLSAIKQLEIWYRKENGN
QLYKSFEGHPYYFQAEDSFNIDQIKLNFFSHHKEKSHFIYDQEVLQNGQLFSMSSPGSLI
FLTSKLTYEFQDQKDEWIAQHKIESYK