Identifiers and Description

Gene Model Identifier

TTHERM_00243800

Standard Name

PPI5 (peptidylprolyl isomerase 5)

Aliases

PreTt02375 | 21.m00206

Description

PPI5 peptidyl-prolyl cis-trans isomerase cyclophilin-type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19462.1 3.999284652801983e-113
Description: peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein (189 aa)
WormBase WBGene00000883 3.999031314999233e-77
Description: locus:cyn-7 Peptidyl-prolyl cis-trans isomerase 7 status:Confirmed UniProt:P52015 protein_id:CAA21760.1
DictyBase DDB_G0282359 8.002162267243937e-73
Description: ppiA on chromosome: 3 position 5684660 to 5685426
SGD YDR155C 9.997863464222902e-69
Description: CPR1 Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A
Oxytricha Contig22608.0.g34 6.997942222381785e-66
Description: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Stentor Coeruleus SteCoe_27746 4.906094730649281e-35
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00243800(coding)
ATGAACGTTTTCAAGCTTATTAGTAAATTTTCTTCTTCAAAGAACCCTAAGGTTTTCTTT
GATATGGCTATAAATGGTAATCCTAGCGGAAGAATGGTCTTTGAGCTTTATGCTGATGTT
GTCCCAAAGACTGCTGAAAACTTCAGAAGACTTTGCATCGGAGATGCCAAGTCTGTTACT
AGTGGTAAACCTTTGACCTATAAAGGTAGTATTTTCCATAGAATTATTCCTAGATTTATG
TGCTAGGGAGGTGATATTACTCACCATAACGGAATGGGTGGTGAATCTATTTATGGAAGA
AAATTCCCTGATGAAAACTTTAAATTGAATCACACTGGTCCTGGTATTTTATCTATGGCT
AATTCTGGTCCTAACTCTAATGGATCATAATTCTTTATCACAACAGTACCCTGTGATTGG
TTAGATGGCAAGCATGTAGTATTCGGAAAGCTCATTTAGGGTCAAGAAGTCCTCTCTCTC
TGCGAATAATAAGGTAGATCTAACGGATAAACCAAATCCGTTGTTACTGTTACTGATTGC
GGTGAAATTTCTGCTGAAAAATAATAGTGA


>TTHERM_00243800(gene)
ATGAACGTTTTCAAGCTTATTAGTAAATTTTCTTCTTCAAAGAACCCTAAGGTTTTCTTT
GATATGGCTATAAATGGTAATCCTAGCGGAAGAATGGTCTTTGAGGTATTAAATATTTAA
ATACAAAAGGAACTTACTTGAAATATCATTTATGATAAATAATTATATAGCTTTATGCTG
ATGTTGTCCCAAAGACTGCTGAAAACTTCAGAAGACTTTGCATCGGAGATGCCAAGTCTG
TTACTAGTGGTAAACCTTTGACCTATAAAGGTAGTATTTTCCATAGAATTATTCCTAGAT
TTATGTGCTAGGGAGGTGATATTACTCACCATAACGGAATGGGTAAAAAATTTATAATAT
AAAATTAAACATATGAGATCTGATAATATAGATTTTATTTTTAAAATCTCGCGATTCATT
AACATTTTAACAAATTTTCTTTCTATTAAAAGGTGGTGAATCTATTTATGGAAGAAAATT
CCCTGATGAAAACTTTAAATTGAATCACACTGGTCCTGGTATGAAAAGCTTAAACATATT
TTACTATTTATATTTCAAAGATCGTCTAAAAGAAATTAAACTTTCTACCAAAAAATTAGA
ATTTAAATAAAGAATTTTCTACATTATTGCCAAATTTTAGATTATAAAACATCAAATATT
ATTTTATAGGTATTTTATCTATGGCTAATTCTGGTCCTAACTCTAATGGATCATAATTCT
TTATCACAACAGTACCCTGTGATTGGTTAGATGGCAAGCATGTAGTATTCGGAAAGCTCA
TTTAGGGTCAAGAAGTCCTCTCTCGTATCTTTTTATTTAGATTTGAAATATATTAAAAAA
TTCTTAAAATTATTTATTCTATACTAATAGTCTGCGAATAATAAGGTAGATCTAACGGAT
AAACCAAATCCGTTGTTACTGTTACTGATTGCGGTGAAATTTCTGCTGAAAAATAATAGT
GA


>TTHERM_00243800(protein)
MNVFKLISKFSSSKNPKVFFDMAINGNPSGRMVFELYADVVPKTAENFRRLCIGDAKSVT
SGKPLTYKGSIFHRIIPRFMCQGGDITHHNGMGGESIYGRKFPDENFKLNHTGPGILSMA
NSGPNSNGSQFFITTVPCDWLDGKHVVFGKLIQGQEVLSLCEQQGRSNGQTKSVVTVTDC
GEISAEKQQ