Identifiers and Description

Gene Model Identifier

TTHERM_00245740

Standard Name

NRK2 (NIMA-Related Kinase )

Aliases

PreTt02469 | 21.m00300

Description

NRK2 plant dual-specificity MAP kinase kinase family domain protein; NIMA (Never In Mitosis) related kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF01163 ) RIO1 family
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00513.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (544 aa)
Oxytricha Contig16193.0.g77 6.000667945664035e-116
Description: Protein kinase domain
DictyBase DDB_G0270814 6.997794455893953e-54
Description: nek2 on chromosome: 1 position 4847143 to 4848761
Stentor Coeruleus SteCoe_34801 1.0377033238158346e-53
Description: None
WormBase WBGene00008956 1.9998745702418095e-48
Description: locus:nekl-3 status:Confirmed UniProt:G5EFM9 protein_id:CAA92169.2
SGD YAR018C 4.9986056260133516e-43
Description: KIN3 Nonessential serine/threonine protein kinase; possible role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00245740(coding)
ATGTCCTTGAAAGATTTTGTGAATTTATAGAAGATAGGTGAGGGCTCTTACTCAAGTGTC
CATAAAGTAAGAAGGATCTCAGATAACTAAGAATACGCCCTCAAAAAGGTTAAATTATCT
GGTTTAAGCGAAAAAGAGAAAGATAACGCTCTTAATGAGATAAGAATATTAGCAAGTATA
GCTCATCCAAACATGATTGCATATAAGGATGCCTTTTTTGATGAATCTTCTCACTCACTT
TGCATTGTTATGGAGTTAGCCGTCAACGGTGATCTTTCTAAAAAAATTGATAGTGCAAAA
AAAAGAAATAGCTTTGTTCCAGAAGAAGAAATTTGGACAGTAGCGTTGCATATGTTAAGA
GGTTTGAAAGCTATGCACTCCAAAAAGATTCTTCACAGAGACCTCAAGTGTGCAAATGTC
TTTATTTCCAAGCAAGATGAATACAAAATTGGTGATCTCAATGTCTCAAAAGTCGCCAAA
AGAGGACTAGTATACACTTAAACTGGTACTCCTTATTACGCATCACCTGAAGTTTGGAGA
GATGAACCATATGACAGTTCAAGCGATATTTGGTCATTTGGATGCATTTTATACGAATTA
GCAGCTCTTAATCCACCATTTAGAGCTAAAGATATGGAAGGATTGTATAAAAAAGTATAG
AAAGGTATATTTGAGAGAATTCCATAAAGATATTCTAATGATTTGTAGAAGTTTATTGCA
TTATGCCTTTAGGTTAGTAGTGTATAACGTCCTTCTGTTACTTAGCTTTTAAACAATGTA
CTTCTTAAGCGTAATACCTAATTTTTAGCAGAATCTCCTGAAGAGTAATAAGATAAGGAA
AACACCCTTAGCCCAGAAGACCTTTTAAACACAATCAAAATGCCTAAAAACCCTCGTTAG
CTTAAGGAAAAGCTCCCAAAGCCTTAATATGATAAAGAGATATTAAATAATTCATATGAT
GGAGAAATACAACGCAAGGAGCGTAACCACAATAGGAATATGTCTGTAAAAATGAATAGG
ATATAATCTGTAACCAACCATAAATAGCATTAATACCTATAATAGTAATAGCAACTAATG
TTGGAGTAGGAAGGAAAAGATGTTGTTTTACCTTTAATTCCCAGATCATAATAATAAAAA
ATATTAGAACCTATAAGTAACAGCTAGTTACAGGCATAACAAAATAATAGCAATATTATA
GGTAGCTAAAATGATATTTATTCTAGAATAGGTAGCAACAGATATGAAAATTCTTCATCC
ATAGTTAGTGATTCCAGAAATTACTTGCAGGAAATACAGCCAAAAAAGCGAATTAATTAA
AATGGTTCAAGTGGTAACTACAATGAAGATTACTCCTAAAAATATAATAGATATGATTAA
CAACCAAGGTCAATAAACTCTCCAACTATATCTGTAATTTCTAAAAAGGATACAGGGTAT
TCAAATCCAGTGAACTCCATTAATCCACTAAGAAACAGAGTTAATTCTATAAATCAAATC
AATAGTTATGCAAGAATAGCTAATTTATATTAAAATTCTAAAAATCCCTATAACAACTAC
AGCGGAAATTCGATGCAGAGTGTTTCAATCGACTACAATCCTTAATATTCTCGTCCTGTT
TGGTGGGGTTGA


>TTHERM_00245740(gene)
ATGTCCTTGAAAGATTTTGTGAATTTATAGAAGATAGGTGAGGGCTCTTACTCAAGTGTC
CATAAAGTAAGAAGGATCTCAGATAACTAAGAATACGCCCTCAAAAAGGTTAAATTATCT
GGTTTAAGCGAAAAAGAGAAAGATAACGCTCTTAATGAGATAAGAATATTAGCAAGTATA
GCTCATCCAAACATGATTGCATATAAGGATGCCTTTTTTGATGAATCTTCTCACTCACTT
TGCATTGTTATGGAGTTAGCCGTCAACGGTGATCTTTCTAAAAAAATTGATAGTGCAAAA
AAAAGAAATAGCTTTGTTCCAGAAGAAGAAATTTGGACAGTAGCGTTGCATATGTTAAGA
GGTTTGAAAGCTATGCACTCCAAAAAGATTCTTCACAGAGACCTCAAGTGTGCAAATGTC
TTTATTTCCAAGCAAGATGAATACAAAATTGGTGATCTCAATGTCTCAAAAGTCGCCAAA
AGAGGACTAGTATACACTTAAACTGGTACTCCTTATTACGCATCACCTGAAGTTTGGGTA
ATTTAGTTTAAAAAATAATTTATACAAATCATGATTTAAATATTTGAAGAGGATTGGTAT
GTTTTTAATTTTTATCAAGCCAATAACATTCAAAAAAAAATGGAAATATATTAAGCAAAT
AAATGAAAGGTTATCTTACCAAATGAATGATGGTACATTTCATTTTACATCTTAGTGCAA
TAATTAGTAATAGTTTTGATAAATAGAATTAAAGAACAAGTTAACAAACAAACAACAAAT
TCCTATTGATTTATTAACTACTTTGTCAAAAATAACTCTTATTTAATCTTTGATTCTATT
TTTTACGTTCCATTCAATTTGCTATTAAAAATAGAATTTTTAAATTTTAAGAGATTCTTT
AAGATATTATCTTAATTGCGTTTCTTTTTTCAGTCAATCTTTGATTTAATCGTTCATGAA
TGAAATGTTATATATTATTGCTGCCTTTATAGAATAACAAATACAAAAAAAATTATAAAT
TTTAACTCATTATCAAATCTAAAAGCTAATTAATTCCTTAATTTGTTTGGACTAAAGAGA
AGCAACGCACATATAAAAAAATTTATAATTTTAAAATCAAGCAAGATAAATTTTAAAGAG
TTTATTTTTGAGGGTAGCATAGATCAATTAATTCATAAGAAATTTTTAAATATACTGAAT
AGAAATTTAATCATAAATTAATTCTAGAATAAAAAAATCCTCTTATTTTTTATGATGAAA
AATAATTAAATATACAAATAAATTAATAACTATATTTTTTATTTTAGAGAGATGAACCAT
ATGACAGTTCAAGCGATATTTGGTCATTTGGATGCATTTTATACGAATTAGCAGCTCTTA
ATCCACCATTTAGAGCTAAAGATATGGAAGGATTGTATAAAAAAGTATAGAAAGGTATAT
TTGAGAGAATTCCATAAAGATATTCTAATGATTTGTAGAAGTTTATTGCATTATGCCTTT
AGGTTAGTAGTGTATAACGTCCTTCTGTTACTTAGCTTTTAAACAATGTACTTCTTAAGC
GTAATACCTAATTTTTAGCAGAATCTCCTGAAGAGTAATAAGATAAGGAAAACACCCTTA
GCCCAGAAGACCTTTTAAACACAATCAAAATGCCTAAAAACCCTCGTTAGCTTAAGGAAA
AGCTCCCAAAGCCTTAATATGATAAAGAGATATTAAATAATTCATATGATGGAGAAATAC
AACGCAAGGAGCGTAACCACAATAGGAATATGTCTGTAAAAATGAATAGGATATAATCTG
TAACCAACCATAAATAGCATTAATACCTATAATAGTAATAGCAACTAATGTTGGAGTAGG
AAGGAAAAGATGTTGTTTTACCTTTAATTCCCAGATCATAATAATAAAAAATATTAGAAC
CTATAAGTAACAGCTAGTTACAGGCATAACAAAATAATAGCAATATTATAGGTAGCTAAA
ATGATATTTATTCTAGAATAGGTAGCAACAGATATGAAAATTCTTCATCCATAGTTAGTG
ATTCCAGAAATTACTTGCAGGAAATACAGCCAAAAAAGCGAATTAATTAAAATGGTTCAA
GTGGTAACTACAATGAAGATTACTCCTAAAAATATAATAGATATGATTAACAACCAAGGT
CAATAAACTCTCCAACTATATCTGTAATTTCTAAAAAGGATACAGGGTATTCAAATCCAG
TGAACTCCATTAATCCACTAAGAAACAGAGTTAATTCTATAAATCAAATCAATAGTTATG
CAAGAATAGCTAATTTATATTAAAATTCTAAAAATCCCTATAACAACTACAGCGGAAATT
CGATGCAGAGTGTTTCAATCGACTACAATCCTTAATATTCTCGTCCTGTTTGGTGGGGTT
GA


>TTHERM_00245740(protein)
MSLKDFVNLQKIGEGSYSSVHKVRRISDNQEYALKKVKLSGLSEKEKDNALNEIRILASI
AHPNMIAYKDAFFDESSHSLCIVMELAVNGDLSKKIDSAKKRNSFVPEEEIWTVALHMLR
GLKAMHSKKILHRDLKCANVFISKQDEYKIGDLNVSKVAKRGLVYTQTGTPYYASPEVWR
DEPYDSSSDIWSFGCILYELAALNPPFRAKDMEGLYKKVQKGIFERIPQRYSNDLQKFIA
LCLQVSSVQRPSVTQLLNNVLLKRNTQFLAESPEEQQDKENTLSPEDLLNTIKMPKNPRQ
LKEKLPKPQYDKEILNNSYDGEIQRKERNHNRNMSVKMNRIQSVTNHKQHQYLQQQQQLM
LEQEGKDVVLPLIPRSQQQKILEPISNSQLQAQQNNSNIIGSQNDIYSRIGSNRYENSSS
IVSDSRNYLQEIQPKKRINQNGSSGNYNEDYSQKYNRYDQQPRSINSPTISVISKKDTGY
SNPVNSINPLRNRVNSINQINSYARIANLYQNSKNPYNNYSGNSMQSVSIDYNPQYSRPV
WWG