Identifiers and Description

Gene Model Identifier

TTHERM_00257230

Standard Name

HMGB2 (High MoBility group 2)

Aliases

HMG C | LG2 | HMG-C | PreTt25409 | 22.m00354

Description

HMGB2 HMGC high mobility group (HMG) box protein; High-Mobility-Group (HMG) protein; may play a role in the bending or looping of DNA; present in both macro, and micronuclei but with elevated expression during both macronuclear S phase and endoreplication of developing new macronuclei; hypothetical protein

Genome Browser (Macronucleus)

Full Screen View


Genome Browser (Micronucleus)

Full Screen View

External Links

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31932604: Nabeel-Shah S, Ashraf K, Saettone A, Garg J, Derynck J, Lambert JP, Pearlman RE, Fillingham J (2020) Nucleus-specific linker histones Hho1 and Mlh1 form distinct protein interactions during growth, starvation and development in Tetrahymena thermophila. Scientific reports 10(1):168
  2. Ref:8264578: Wu M, Allis CD, Sweet MT, Cook RG, Thatcher TH, Gorovsky MA (1994) Four distinct and unusual linker proteins in a mitotically dividing nucleus are derived from a 71-kilodalton polyprotein, lack p34cdc2 sites, and contain protein kinase A sites. Molecular and cellular biology 14(1):10-20
  3. Ref:8417323: Wang T, Allis CD (1993) An abundant high-mobility-group-like protein is targeted to micronuclei in a cell cycle-dependent and developmentally regulated fashion in Tetrahymena thermophila. Molecular and cellular biology 13(1):163-73
  4. Ref:1589033: Lilley DM (1992) DNA--protein interactions. HMG has DNA wrapped up. Nature 357(6376):282-3
  5. Ref:1480473: Wang T, Allis CD (1992) Replication-dependent and independent regulation of HMG expression during the cell cycle and conjugation in Tetrahymena. Nucleic acids research 20(24):6525-33
  6. Ref:1991550: Schulman IG, Wang TT, Stargell LA, Gorovsky MA, Allis CD (1991) Cell-cell interactions trigger the rapid induction of a specific high mobility group-like protein during early stages of conjugation in Tetrahymena. Developmental biology 143(2):248-57
  7. Ref:1986218: Schulman IG, Wang T, Wu M, Bowen J, Cook RG, Gorovsky MA, Allis CD (1991) Macronuclei and micronuclei in Tetrahymena thermophila contain high-mobility-group-like chromosomal proteins containing a highly conserved eleven-amino-acid putative DNA-binding sequence. Molecular and cellular biology 11(1):166-74
  8. Ref:2514183: Suda M, Hayashi H (1989) A protein that accumulates during starvation in Tetrahymena nuclei. Journal of biochemistry 106(4):612-5
  9. Ref:2476991: Hamana K, Kawada K (1989) Release of nucleosomes from nuclei by bleomycin-induced DNA strand scission. Biochemistry international 18(5):971-9
  10. Ref:2760016: Hayashi T, Hayashi H, Iwai K (1989) Tetrahymena HMG nonhistone chromosomal protein. Isolation and amino acid sequence lacking the N- and C-terminal domains of vertebrate HMG 1. Journal of biochemistry 105(4):577-81
  11. Ref:3584238: Schulman IG, Cook RG, Richman R, Allis CD (1987) Tetrahymena contain two distinct and unusual high mobility group (HMG)-like proteins. The Journal of cell biology 104(6):1485-94
  12. Ref:3109974: Prasanna P, Holmlund CE (1987) Identification in Tetrahymena pyriformis of 3-hydroxy-3-methyl glutaryl coenzyme a lyase: its purification and properties. The International journal of biochemistry 19(4):385-9
  13. Ref:3671074: Roth SY, Schulman IG, Cook RG, Allis CD (1987) The complete amino acid sequence of an HMG-like protein isolated from the macronucleus of Tetrahymena. Nucleic acids research 15(19):8112
  14. Ref:6849878: Levy-Wilson B, Denker MS, Ito E (1983) Isolation, characterization, and postsynthetic modifications of tetrahymena high mobility group proteins. Biochemistry 22(7):1715-21
  15. Ref:6258140: Hamana K, Zama M (1980) Selective release of HMG nonhistone proteins during DNase digestion of Tetrahymena chromatin at different stages of the cell cycle. Nucleic acids research 8(22):5275-88
  16. Ref:117005: Hamana K, Iwai K (1979) High mobility group nonhistone chromosomal proteins also exist in Tetrahymena. Journal of biochemistry 86(3):789-94

Sequences 

>TTHERM_00257230(coding)
ATGGCCAAATCAAAAGACGACAGCAAGCCCGCTCCCCCCAAGAGACCCTTATCCGCTTTC
TTCTTATTCAAGTAACACAACTACGAATAAGTCAAGAAGGAAAACCCCAATGCCAAGATC
ACCGAATTGACCTCCATGATCGCTGAAAAGTGGAAAGCTGTTGGTGAAAAGGAAAAGAAG
AAATACGAAACTTTATAATCTGAAGCTAAGGCTAAGTACGAAAAGGACATGTAAGCCTAC
GAAAAGAAGTACGGCAAACCCGAAAAGTAAAAGAAGATCAAGAAGAACAAAAAGGGATCC
AAGTGA



>TTHERM_00257230(gene)
AATACAAAAGAAAAAAATCAATAAAAAAACACATCAATCTAAAATGGCCAAATCAAAAGA
CGACAGCAAGCCCGCTCCCCCCAAGAGACCCTTATCCGCTTTCTTCTTATTCAAGTAACA
CAACTACGAATAAGTCAAGAAGGAAAACCCCAATGCCAAGATCACCGAATTGACCTCCAT
GATCGCTGAAAAGTGGAAAGCTGTTGGTGAAAAGGAAAAGAAGAAATACGAAACTTTATA
ATCTGAAGCTAAGGCTAAGTACGAAAAGGACATGTAAGCCTACGAAAAGAAGTACGGCAA
ACCCGAAAAGTAAAAGAAGATCAAGAAGAACAAAAAGGGATCCAAGTGAGAACTTTTCTA
ATGATAATAATTATAATTAATACAGCAGCACCATAGCATATTGACCTATTAATTAACAAC
ATTTTGTTTTTATTCATATAAAATCTTAATAAATACAATATATACTATCCTTAACTAGTA
TGTTCATATTCTTGTGTGTTAGAGTAAGAAGTTATTATATCTTCTTTGAGTTATTA



>TTHERM_00257230(protein)
MAKSKDDSKPAPPKRPLSAFFLFKQHNYEQVKKENPNAKITELTSMIAEKWKAVGEKEKK
KYETLQSEAKAKYEKDMQAYEKKYGKPEKQKKIKKNKKGSK