Identifiers and Description

Gene Model Identifier

TTHERM_00260780

Standard Name

NRK15 (NIMA-Related Kinase)

Aliases

PreTt29341 | 23.m00237

Description

NRK15 Serine/Threonine kinase domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF04702 ) Vicilin N terminal region
  • ( PF07714 ) protein tyrosine kinase
  • ( PF08251 ) Mastoparan peptide
  • ( PF08260 ) Insect kinin peptide
  • ( PF08619 ) Alkali metal cation/H+ antiporter Nha1
  • ( PF08729 ) Histone promoter control 2 (HPC2)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01612 ) rhoptry protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13672.1 9.997863464222902e-69
Description: protein kinase domain-containing protein (942 aa)
Oxytricha Contig18354.0.g51 8.999789881836428e-67
Description: Protein kinase domain
DictyBase DDB_G0275241 2.000214949834694e-50
Description: nek3 on chromosome: 2 position 4983790 to 4987279
WormBase WBGene00021461 3.00039543526891e-44
Description: locus:nekl-1 status:Partially_confirmed UniProt:Q6AW07 protein_id:CCD69902.1
SGD YJL164C 2.0006622580855403e-35
Description: TPK1 cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; partially redundant with Tpk2p and Tpk3p
Stentor Coeruleus SteCoe_32875 2.6786369618080778e-33
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00260780(coding)
ATGGATCAATTATTTAATTGTGTTAACTTACCTGGCGGCTATGTATTGAAAAAAAAAATA
GGTTAAGGTAATTATGGTTAAGTGTATTTGGTATAAAGTCAACGTGATGGTAGTATATTG
GCGATAAAAAATATTTCTACTCAAAATATGATCTTTGAGGATTTAGAAAAATGCTTAAAA
GAATGCACAATCCTACAGAAGCTTGATAATCCTCATATAGTTAAGTTCAAGAAGGCTATT
AATTAACCAAACAAATAAATGATTTATATCATGATGGAGTACGCAGAAGGTGGAGACTTA
AGAAAAAAAATAAAAGAATAGAAATAAACTGGAAAACTATTTGAAGAAGATTAAATCTTA
GATTGGTTTATTCAAATTTGCTTGGGCTTGAAGTATATTCATAAAAATAAAATAATTCAC
AGAGATATCAAACCTGAAAATATATTTTTAACTGCCGACAATAGAGTGAAGATTGGTGAT
TTCGGAATATCAAAAGAACTTGAATATACCAACCAATAGCTATATTCAAGAATTGGGACT
CCTTACTATTTAGCTCCAGAAATGATAAAAGGAGAACTTTATAATTCAAGCGTTGATATT
TGGTCTCTTGGTGTTGTTTTATATGAGCTGTGCTGTCTTAAACCTCCTTTTAATAGCTGG
AATGAATATATTATTTATTATAAAACTTATAAGAAACCCTATCCGCCTATTACTCAAGCT
TAATACTCACCCTAGCTTAAAACATTAATATCTAAACTCCTGATAAAATCCCCAGAAGGA
GAAAGAGGTCGTTATACTCTAGAGTAAATATTAAATGAACCCCTTATTAAAAATCGACTC
AAATAAAAATTTTTTTAAGGTAGAAAATAGTCTCCTTATGAATACTTTAAAGATAATAAT
AATAAAAATGTAAATAAAATATAGCAGCAGCATGTTTAAAACAATATTATTCAAGAAAAT
TTGATTCCAACTCCAGCTAAATTCTAAAATTTACAAAATAAAAAATAATAATTAAATGAT
ATTATGCCAAACATCTATCGTGCAAAGGATTATTCATAAGAATAATTCAAAAATTAATCG
GTTGATATGAGAAAATTAAATATATTTGGCCAAAAAGAGTAATCTAATCTTGGAAAAATA
AATGAAATTATGAGTTGTAAACCAAACTTTAAAAAATAATCAGATATTTTTGATAGAAAT
CTATCTAAACAACCAGTTAATGATCTAACAAAACAATAAAAGGCATATTTAAGTCCTAAT
ATTCATCTGAACAGAAATTAATTGAAAAACAATCAACAATAAGGACTTAATTAGTTAAAA
TAAGACAATAAGTAGAATACTTAATTTCAAAAATAGATTTTACCTAATCAGAAAGATCTT
TACACTGATATCCAGCTTGATTAAAGTCCTCGACAAATATTAAAAAATAAGAAAAAATAA
GGTGATGTGTAGTATGATTTAAATAAAGTAGAAGTAGCTAATCAAAATAATAATAATAAA
GAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAGTAGACCACTTAATCTCAA
AAATAGATTTTACCTAATCAGAAAGATCTTTACACTGATATCCAGCTTGATTAAAGTCCT
CGACAAATATTAAAAAATAAGAAAAAATAAGGTGATGTCTAGTATGATTTAAATAAAGTA
GAAGTAGCTAATCAGAATAATAATAATGATAATAATAATAATAAAGAAGAAGAAGAATAA
AATAGTAAAACTAAATAAGACTATGAGTAGAGCACTTAATCTCAAAAATAGATTTTACAT
AATCAGAAAGATCTTCACACTAATACCCAGCTTTATTAAAGACCTCTACAAATATTAAAA
AATAAGAAAAAATAAGGTGATGTGTAAGATTTAAATAAAGTATAAGTAACTAATCTGAAT
AATAATAATAATAAAGAAGAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAG
TAGAGCACTTAATCTCAAAAATAGATTTTACCTAATCAGAAAGATCTTCACACTGATATC
CAGCTTGATTAAAGTCCTCTAGAAATATTATAAAATGAGAAAAAATAAGTAGATATGTAA
GATTTAAATAAAGTAGAAGTAACTAATCAGAATAACAATAAAGAAGAATAAAATAATAAA
ACTCAATCTAATCTATCAATAAAGAGCTAAAAGACTTTTGAAACTAATAACAGCACTTAT
TTTTTTTAGTAAAGCAATGAAACCTACGAATCTGATACAATACCTGCCATTTAGAAAAAT
AATCTGTAAAATATCAATTTAATAGACTAAGTTTAAAATAAAACTAGATTGACATATAGA
AAAAAAAACAAAGATAGCAATGAGGAAGATCAAAAAAATAAAGAACCTATTTTTTATTAA
CCAAATAATCAACAATAAAAGCTGAAAAATAATGAATCAAATGACTAGGATTTTAAATTA
GAGCCTAAGATTTAGTCAACAACTGATTAAAGCAGCTAGAAACTACAAAAATAAACTCAA
ATAGACGAGGTATTTTAATCTCCAAATAATTCTACTTAAATCACTCAAAAAGGAAAAGAT
GATCAAAATTATCCTGTACGTATAACTGCTAAAGTAGTGAGTAAATGCAAAAATTAAATC
AGTGAACCAGAAAAATAAAATACTGAATTTGAAATAAAAACAAAATCAAATCCTAAATAA
GCTGATGAAATTCCAATTACTCCAATCAAACCAGGTTAAAAAGATTTGAATACAGAATTA
AATGATAATTCTCAAGAACAAAAAAATCTTTCTAAAACAAAAAGAAATATTTCTAAAGAA
TAGGAATTTAGCACTGCTGCTTCTTGCAAATTAATAACTTTAAATAAGGAGTAATCATTA
GAGAAGAATTCGTAAGATCCATATGAATTAAAAACTCATAATTAATCTTTGGGATAAGTT
ATTGAAGAAATGGAAGCGAAATCTAACAAAGATAATTAAGTAAATCGCAGAATCTCCTTT
GAAAGTGCTTTAAAATTATAAGATTAAGAAAACAACTCAAATAAAAAAACTCCTTAATAA
TTTAGCTTTTTTGATAATAACGAACAATAACTAAGCCCAAATTTAATTCAAAAAGAGCTG
TTGGATGATACATCTCAAAACAAATAAGAAAAAATTGACAACTATTTTTTTGAAGAAATT
GAAGAGGATATTTGCCCATACGAATAACCTGAAGAGGAATCTTAAAATGACATGAATACA
CGACTTACTTAATTGGAAAGTAAAACTGATCCAAGTAATCTCAAGGATACCAATAAAGAT
AATCAGAAAAATAAGCTTTAGGATAATTATCATTAACTAATAGATGATAAAAGCATGCAT
TGCGATGATAAAGAATCTGATGTCGAAGATTCTTTTTATGAAGAAGATCAAGAAGAAGAA
GAAGAAGATGATGAAGAAGAAGATAACATTTATATCATTCCAAGCAAATAATCTGAATCA
TTTAAAAAATTGAAGGTTAGTCTCTTATAAGACATGGATTAAGAGTAATTCTAACTATTT
TCAAACATAGTAAAAAAGGAGGTTGAAGAACGAACTATGTAATCTAGGGATCTAGAATTT
AATAATTTTAATATACCTGAGAGCTATTTATGGATAAAATAAATAGGCTATGGTTCATAG
GGTTAAGTGCATTTGATAGAAAGTAAAGAAGATAGTAGTAAATTGGCGATAAAAAATATA
TCTACTAAAAATATGAGCTAATAGTAGAAAAGAAAACACTAAGATGAATACAGATGCTTG
CAGAAGCTTGATCATATAGTTAAATTCAAGAAAGCCATTCATTGTATAAATAACTAAATG
ATTTAGATCATTATGGAGTACACAGAAGGCGGAGACTTACAAAAAGCAATAGAAAAGTAG
ATATAAATTGGAAAACCATTTGAAGAAGAGTAAATTTTAGATTGGTTTGCACAAATTTGC
TAGGGTTTGAAATATATTCACGAAAATAAAATAATTCACAGAGATATTAAACCTGCAAAT
TTATTTTTAACTGCATAGAATACAGTGAAAATTGGTGATTTCGGAGTAGCAAAAGAACAA
AAATATACCAACGAATAACTATCTTCATAAATTGGGACGCCTTACTATTTAGCTCCAGAA
ATTATAGATGGAAAACCATATAATTCAAGTGTTGATATTTGGTCTCTTGGTGTTGTTTTA
TATGAGCTGTGCTGTCTTAAACCTCCTTTTAATAGCTGGTGTGAAGCTGGTCTTTATTAT
AAAAGTAAAAATTTGCCCTATCCGCCTATTCAAGCTAAATACTCAAAAAAACTTAAAGAG
TTAATATCTAAACTCTTGAGAAAGTCCCCAGATGATCGTTATACTTTACAAGAAATATTA
GATGAGCCCTTTATTAAAAATCGACTCAAAAAAAAATCTTCTTCGAAAGATAGATAATAG
TCTCCTAATAAATTCTTTAATGATAATAAAAATATAAATTCTCTGTAACAAAATAAAAAA
GTAATTAACATTTTACCTGTTTAAAACAATATAATTCAACAAAATTTCATTCCAAACTCA
GCTAAATACTAAAATTTACAAGATAAAAAGTAATAATTAAATGATATTCGTCCAAATAGC
TGTCGTGCAAAAAAGGATTATGTATAAGAATAATAATAAAATGAATCTGTTGATAAGACA
AAAAATTTAAATATACTTGAAAAAGTAAATGTACCAATGAGTTGTAAACAAAATTCTTAA
AAATAATTAGATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAATTAATTTGGCC
AACAAGAATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAATAAATGTACCAATG
AGTTGTAAACAATAATCTTAAAAATAATAAAATAAATATATTTTAATTAAAAACCCATTC
ATACAACAAGTTAATGATTTAGCAAAACGATAAAATACAGATTCAACTTCTTACTTTTAA
TTGGACAGAAAATTATTGAAACGCTACCAACAATAAGGACTTAATTAGTTAAAATAAGTC
TATGAGTAAAGAAATTAATCTCTAAAACAGATTTTTCCTAATAGGAAAGATATTAATGTT
TTAAATAAAGCAGAAGTAACTGATGACAATAATAACAATAAAGAAGAAAATAATAAAACT
CCAGCTACTCAATCAATAAAGAATATAAAGACTTTTAAAACTTAAAACAGCGATTATTTC
AGTGGAAATAGTACTTAGTAAAGCAATGAAACATAGGAATCTGATAAAAAATCTGCCATT
TAGAAAAATAATCAAGGCTAAATTCAATCTAAACGTCGATTATCATAAAAAATAAAAAAC
ATAGCTAGAAATGAGGAAGATCAAAAAAATAAAGAAGCTATTTTTTTCTAACCAAATAAT
CAACAATAAAAACTGAATAATAATGAATCAAATTACTAGGATTTTAAATTAGAGCCTAAG
AAATAAGAAACTCAACTGAATCTACAAGAATAAAATAAATATGATGATATTAAATAGATT
GAAACACCAAAATCACCTATTAAAACAATTAAAAGTAATGACTTTTGTACTTAATAAAAT
AATCTACCAGCTACAGTATACCTGAAAGATGTTGTATAATAAGAAGAAAAAAAAATAGAT
ATCAATAAAGAAAATATAAATGAAAATAATTAGATAAAATACGAAGAAATTTAAATTACT
AGAAGAATAACTGCAAAAGTAGTTAGTAAATGCAAAAAATAAGTCAGTGAACCAGAAAAA
TAAAACACTCAATGTGAAATAAAAACAAAATCGAACCCGAAATAGGCTGATGAAACTCCA
ATTACTCCAATCAAATCAGATTAAAAAGATTTGAATACAGAATTAAATGGTAATTCTCAA
GAACAAAAAAATCTATCTAAAACAAAAGAAAATATTTCTAAAGAATAAGAATTCAACAGT
GCTGCTTCTTGCAAATTATTAACCGAAAAAAAAAATAATTTTGTAGCTAAGGAGTAATGT
TAAGAGAAGAATTCTTAAGATCTATCTGAATAAAAAACTCAAAAATAATCTTTAGGATAA
ATAATTGAAGAAGAGGATGAATTTGTTTCACAATCTAACAAAGAAAATTATATAATTCGC
AGAATCTCCTTTGAAAGTGCTTTAAAATTATAAGATTAAGAAAACAACTAAAATAAACAA
ACTCCTTAATAATTAAGCTTTTTTGAAAAAAACTAACAAAATCTAACACCAGATTTACTT
CAAAAAGAGTTGTTGGGTGAGAAATCTCAAAATAAATCAGATTATTAGAAAAGTAAACTC
ATATATAGTCATCTTAAACTAATTCATGATGAAAACTTGTATTATGATGATAAAAAATCC
TATGACGGATATTATTATGAAGAAGATGAAGTAAAAAAAAAATAAGAAGAAGAAGATGAA
GAAAATATTTATATCATTCCAAGTAAATAATCAGAATAATTTAAAAAATAGAAGGTTAGT
CTATTAAAAGACATGACGCAAGAGTAATTCTAACTATTTTTCAACATAGTAAGAAAGGAG
ATATAGAATGAAAGATTCATAAATGATACAACAAAGAACTAAATAAATATTTTATAAACA
TAGATTCCCTAAGTTCAACTAGATAAATTGAATATTAAAATAAAATCATTTATTGATATT
GTTAAGATAGAAAACTCTGATTTATAGATTGAAAATTTTTGA


>TTHERM_00260780(gene)
ATGGATCAATTATTTAATTGTGTTAACTTACCTGGCGGCTATGTATTGAAAAAAAAAATA
GGTTAAGGTAATTATGGTTAAGTGTATTTGGTATAAAGTCAACGTGATGGTAGTATATTG
GCGATAAAAAATATTTCTACTCAAAATATGATCTTTGAGGATTTAGAAAAATGCTTAAAA
GAATGCACAATCCTACAGAAGCTTGATAATCCTCATATAGTTAAGTTCAAGAAGGCTATT
AATTAACCAAACAAATAAATGATTTATATCATGATGGAGTACGCAGAAGGTAAATTTTTA
TTTATTTAAATATGTTCTTACTCTTTCTAAATGAAAGATATTATTGTTAATTTTTTGATT
AGTATATTTTTTTGATATCCTATAAAGACCTAAATATTATTTAATTTAAATAATATTTGC
AATCAAACATATAAATAAATAAATATATTCATCATTAATTAAATAAAATAACACAAAGGT
GGAGACTTAAGAAAAAAAATAAAAGAATAGAAATAAACTGGAAAACTATTTGAAGAAGAT
TAAATCTTAGATTGGTTTATTCAAATTTGCTTGGGCTTGAAGTATATTCATAAAAAGTAT
AAAACTAATATATAAATAAATAGAATTAATTATAAATTTATTTATTTAACTAATTAAAAA
ATATTTTATAAAAAAGTAAAATAATTCACAGAGATATCAAACCTGAAAATATATTTTTAA
CTGCCGACAATAGAGTGAAGATTGGTGATTTCGGAATATCAAAAGAACTTGAATATACCA
ACCAATAGCTATATTCAAGAATTGGGACTCCTTACTATTTAGCTCCAGAAATGATAAAAG
GAGAACTTTATAATTCAAGCGTTGATATTTGGTCTCTTGGTGTTGTTTTATATGAGCTGT
GCTGTCTTAAACCTCCTTTTAATAGCTGGAATGAATATATTATTTATTATAAAACTTATA
AGAAACCCTATCCGCCTATTACTCAAGCTTAATACTCACCCTAGCTTAAAACATTAATAT
CTAAACTCCTGATAAAATCCCCAGAAGGAGAAAGAGGTCGTTATACTCTAGAGTAAATAT
TAAATGAACCCCTTATTAAAAATCGACTCAAATAAAAATTTTTTTAAGTAAATCAATATT
ATTTATTTATTTATTTACAAATATTTAAGCTAAATTTATTTCTTATTATTTTTTAGGGTA
GAAAATAGTCTCCTTATGAATACTTTAAAGATAATAATAATAAAAATGTAAATAAAATAT
AGCAGCAGCATGTTTAAAACAATATTATTCAAGAAAATTTGATTCCAACTCCAGCTAAAT
TCTAAAATTTACAAAATAAAAAATAATAATTAAATGATATTATGCCAAACATCTATCGTG
CAAAGGATTATTCATAAGAATAATTCAAAAATTAATCGGTTGATATGAGAAAATTAAATA
TATTTGGCCAAAAAGAGTAATCTAATCTTGGAAAAATAAATGAAATTATGAGTTGTAAAC
CAAACTTTAAAAAATAATCAGATATTTTTGATAGAAATCTATCTAAACAACCAGTTAATG
ATCTAACAAAACAATAAAAGGCATATTTAAGTCCTAATATTCATCTGAACAGAAATTAAT
TGAAAAACAATCAACAATAAGGACTTAATTAGTTAAAATAAGACAATAAGTAGAATACTT
AATTTCAAAAATAGATTTTACCTAATCAGAAAGATCTTTACACTGATATCCAGCTTGATT
AAAGTCCTCGACAAATATTAAAAAATAAGAAAAAATAAGGTGATGTGTAGTATGATTTAA
ATAAAGTAGAAGTAGCTAATCAAAATAATAATAATAAAGAAGAAGAAGAATAAAATAGTA
AAACTAAATAAGACTATGAGTAGACCACTTAATCTCAAAAATAGATTTTACCTAATCAGA
AAGATCTTTACACTGATATCCAGCTTGATTAAAGTCCTCGACAAATATTAAAAAATAAGA
AAAAATAAGGTGATGTCTAGTATGATTTAAATAAAGTAGAAGTAGCTAATCAGAATAATA
ATAATGATAATAATAATAATAAAGAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACT
ATGAGTAGAGCACTTAATCTCAAAAATAGATTTTACATAATCAGAAAGATCTTCACACTA
ATACCCAGCTTTATTAAAGACCTCTACAAATATTAAAAAATAAGAAAAAATAAGGTGATG
TGTAAGATTTAAATAAAGTATAAGTAACTAATCTGAATAATAATAATAATAAAGAAGAAG
AAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAGTAGAGCACTTAATCTCAAAAAT
AGATTTTACCTAATCAGAAAGATCTTCACACTGATATCCAGCTTGATTAAAGTCCTCTAG
AAATATTATAAAATGAGAAAAAATAAGTAGATATGTAAGATTTAAATAAAGTAGAAGTAA
CTAATCAGAATAACAATAAAGAAGAATAAAATAATAAAACTCAATCTAATCTATCAATAA
AGAGCTAAAAGACTTTTGAAACTAATAACAGCACTTATTTTTTTTAGTAAAGCAATGAAA
CCTACGAATCTGATACAATACCTGCCATTTAGAAAAATAATCTGTAAAATATCAATTTAA
TAGACTAAGTTTAAAATAAAACTAGATTGACATATAGAAAAAAAAACAAAGATAGCAATG
AGGAAGATCAAAAAAATAAAGAACCTATTTTTTATTAACCAAATAATCAACAATAAAAGC
TGAAAAATAATGAATCAAATGACTAGGATTTTAAATTAGAGCCTAAGGTAATAAAAACAA
AGTATTTTCACATTATCAAACTTATATTATTATATAAAAGATTTAGTCAACAACTGATTA
AAGCAGCTAGAAACTACAAAAATAAACTCAAATAGACGAGGTATTTTAATCTCCAAATAA
TTCTACTTAAATCACTCAAAAAGGAAAAGATGATCAAAATTATCCTGTACGTATAACTGC
TAAAGTAGTGAGTAAATGCAAAAATTAAATCAGTGAACCAGAAAAATAAAATACTGAATT
TGAAATAAAAACAAAATCAAATCCTAAATAAGCTGATGAAATTCCAATTACTCCAATCAA
ACCAGGTTAAAAAGATTTGAATACAGAATTAAATGATAATTCTCAAGAACAAAAAAATCT
TTCTAAAACAAAAAGAAATATTTCTAAAGAATAGGAATTTAGCACTGCTGCTTCTTGCAA
ATTAATAACTTTAAAGTAAATTAATTGTGAAGAAAAGTATTTATTAATTAATTTATTTAT
TTTATCATAAAGTAAGGAGTAATCATTAGAGAAGAATTCGTAAGATCCATATGAATTAAA
AACTCATAGTAAATTGAATTAAAAATAAATTTAATTTTTAGCTAAATAAATTAAAAATAC
TTTGTTAATTAATTAATAAATAAATAGATTAATCTTTGGGATAAGTTATTGAAGAAATGG
AAGCGAAATCTGTAAAATACTTTTAATTTTTTAAATTAAATTAAATTCTTTTCGTAAAAT
AAAGAACAAAGATAATTAAGTAAATCGCAGAATCTCCTTTGAAAGTGCTTTAAAATTATA
AGATTAAGAAAACAACTCAAATAAAAAAACTCCTTAATAATTTAGCTTTTTTGATAGTAA
ATAAGAAGATATTTAATTAATTTAGTTTAAATATTAAAATAGAATTATTAATATATTAAT
TAACTTTCATAAAAATATAAAAAAGATAACGAACAATAACTAAGCCCAAATTTAATTCAA
AAAGAGCTGTTGGATGATACATCTCAAAACAAATAAGAAAAAATTGACAACTATTTTTTT
GAAGAAATTGAAGAGGATATTTGCCCATACGAATAACCTGAAGAGGAATCTTAAAATGAC
ATGAATACACGACTTACTTAATTGGAAGTACTTTATTCTGAAAATAACTACACCTAATTT
TTACTATATTCAATTGTTTTAATAATGCATATTTCAATAAATCATTGAATTTAATTAGAG
TAAAACTGATCCAAGTAATCTCAAGGATACCAATAAAGATAATCAGAAAAATAAGCTTTA
GGATAATTATCATTAACTAATAGATGATAAAAGCATGCATTGCGATGATAAAGAATCTGA
TGTCGAAGATTCTTTTTATGAAGAAGATCAAGAAGAAGAAGAAGAAGATGATGAAGAAGA
AGATAACATTTATATCATTCCAAGCAAATAATCTGAATCATTTAAAGTAATTTTTTCATT
AAAATTCAAATTTATATTAATTTATTTATATTAAATTCATAAATAAAGAAATTGAAGGTT
AGTCTCTTATAAGACATGGATTAAGAGTAATTCTAACTATTTTCAAACATAGTAAAAAAG
GAGGTAAAATTTAAAAATATTTTTAAAAGAAGAAACTATTCAATCAAATATTTCAAATGA
TTTATTTATTAGTTTTTTGTTTATTTTAAAATAATTTTTTAAATAAGAATGATATTAGAT
ATGTTTTATCCATCTTCATCATATACTCAAATATATTTTATTATAAAATTAGATATAAAA
TGAGCGATTCTTAAATTATACACTTAAAAACTAAATAAATATTTTATAGACAAAGATTCC
CTAAGTTCAACTAGATAAATTGAAGTTAAAAATTAAATCATTTATTGATATTGTTTAGAT
AGAAAACTCTGATTTATAGATTGAAAATTTTTGATTTTTTTTCATGAATTAGTAAATTAC
ATTACATTACATAAATAAATAAATAAATGAATACATACATACATACATTACTAGTAGTAA
AAAATATTTGTTCCAAATAAAAATTTTTATTATATTTATTTCTACTTTAAATCACAAAAG
ATTTTGCTTACAAATATTTAGAAAGCCTCAACAGTAATTAATAAATAAATAATCAAATAA
ATTTGAATAAAAAAAAATAAATTAAAATTATTAATAAATTCTTGCTTGCTGCTTTTGTTT
TGAGATTTTGATTTATTATTTAAATTTTCAAAAAAATAATAAATTGTTTTAAACTCTATT
TAGTTTTAAATTGTGTTTGTTTCCCTTAGTAAATAATAAATAAAAAATAGGCGAATAATT
AAATATAAAAATTATATTTTTACTTTAATTTTTGGTTTAGTTTCTTCCTTTTACTTTCAA
TAAATTCTTTTGCTTAGATAGGTAGATACTTGAAGAGTGAATGAATGATTAATCTTTTTG
AATTTTTATTATTTGGTTGGATAATTAATTAAATGATTGATTAATTAATTCTTGATACTT
TCAATATAAATAGCAATAATATTTAAATTTAAAAAATAATCTATTCTTTATTTCTATTGG
GTGATATCATTTAAAAAGCTTAGCGATGATTGAAAAAGAGGATTTATAAATTAGAAATTT
AAAAAAGAGAATAATTTTTAGGCTGATCGATTTTAAGAAAAGTTTCTACTAAAATAATGT
AATATGTATAAAGTTTACTAAAACTCAAGTAAAATATTAATAAAAAAAGATCAGATAGAT
TAGAAATTTAAATCTTTTTCAAAAAATACTAATTAATTAATTAATTAATTAATTTCTTCA
AAAAGTCTAGCCTATTAAAGAAATCAACTTAGTTTATAATCCATTTAAAAGGTTGAAGAA
CGAACTATGTAATCTAGGGATCTAGAATTTAATAATTTTAATATACCTGAGAGCTATTTA
TGGATAAAATAAATAGGCTATGGTTCATAGGGTTAAGTGCATTTGATAGAAAGTAAAGAA
GATAGTAGTAAATTGGCGATAAAAAATATATCTACTAAAAATATGAGCTAATAGTAGAAA
AGAAAACACTAAGATGAATACAGATGCTTGCAGAAGCTTGATCATATAGTTAAATTCAAG
AAAGCCATTCATTGTATAAATAACTAAATGATTTAGATCATTATGGAGTACACAGAAGGT
AAATATTCAAAAATGTTCTCTTTAAATGAAAAAAAAATATTATGATTTATTTATTAATTT
TTTGATGAGTATATATTTTAGATAGATATTCTATAAAGACCTTAATATTATTAAATTCAT
TTATATAATATTTGTAATGAAATATACAAATATATTCATTCATTCATAAATAAATAAATA
CAAAGGCGGAGACTTACAAAAAGCAATAGAAAAGTAGATATAAATTGGAAAACCATTTGA
AGAAGAGTAAATTTTAGATTGGTTTGCACAAATTTGCTAGGGTTTGAAATATATTCACGA
AAAGTATTATAAATAAATAAATAAAATTATTAATCTATTTATTTATTTGATTAAAAAATA
TTTTATAAAAAAGTAAAATAATTCACAGAGATATTAAACCTGCAAATTTATTTTTAACTG
CATAGAATACAGTGAAAATTGGTGATTTCGGAGTAGCAAAAGAACAAAAATATACCAACG
AATAACTATCTTCATAAATTGGGACGCCTTACTATTTAGCTCCAGAAATTATAGATGGAA
AACCATATAATTCAAGTGTTGATATTTGGTCTCTTGGTGTTGTTTTATATGAGCTGTGCT
GTCTTAAACCTCCTTTTAATAGCTGGTGTGAAGCTGGTCTTTATTATAAAAGTAAAAATT
TGCCCTATCCGCCTATTCAAGCTAAATACTCAAAAAAACTTAAAGAGTTAATATCTAAAC
TCTTGAGAAAGTCCCCAGATGATCGTTATACTTTACAAGAAATATTAGATGAGCCCTTTA
TTAAAAATCGACTCAAAAAAAAATCTTCTTCGAAAGTAAATTAATATTATTTATTTTATT
ATAAATTTTTAAGCTAAATTTTATTTTCTTATTATTTTTAGGATAGATAATAGTCTCCTA
ATAAATTCTTTAATGATAATAAAAATATAAATTCTCTGTAACAAAATAAAAAAGTAATTA
ACATTTTACCTGTTTAAAACAATATAATTCAACAAAATTTCATTCCAAACTCAGCTAAAT
ACTAAAATTTACAAGATAAAAAGTAATAATTAAATGATATTCGTCCAAATAGCTGTCGTG
CAAAAAAGGATTATGTATAAGAATAATAATAAAATGAATCTGTTGATAAGACAAAAAATT
TAAATATACTTGAAAAAGTAAATGTACCAATGAGTTGTAAACAAAATTCTTAAAAATAAT
TAGATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAGTAAATGTACCAATAAGTT
GTAAACGAAATTCTTAAAAATAATTATTAGATTAATTTGGCCAACAAGAGTAATCTAATT
TTGAAAAAGTAAATGTACCAATGAGTTGTAAACGAAATTCTTAAAAATAATTAGATTAAT
TTGGCCAACAAGAGTAATCTAATTTTGAAAAAATAAATGTACCAATGAGTTGTAAACAAT
AATCTTAAAAATAATAAAATAAATATATTTTAATTAAAAACCCATTCATACAACAAGTTA
ATGATTTAGCAAAACGATAAAATACAGATTCAACTTCTTACTTTTAATTGGACAGAAAAT
TATTGAAACGCTACCAACAATAAGGACTTAATTAGTTAAAATAAGTCTATGAGTAAAGAA
ATTAATCTCTAAAACAGATTTTTCCTAATAGGAAAGATATTAATGTTTTAAATAAAGCAG
AAGTAACTGATGACAATAATAACAATAAAGAAGAAAATAATAAAACTCCAGCTACTCAAT
CAATAAAGAATATAAAGACTTTTAAAACTTAAAACAGCGATTATTTCAGTGGAAATAGTA
CTTAGTAAAGCAATGAAACATAGGAATCTGATAAAAAATCTGCCATTTAGAAAAATAATC
AAGGCTAAATTCAATCTAAACGTCGATTATCATAAAAAATAAAAAACATAGCTAGAAATG
AGGAAGATCAAAAAAATAAAGAAGCTATTTTTTTCTAACCAAATAATCAACAATAAAAAC
TGAATAATAATGAATCAAATTACTAGGATTTTAAATTAGAGCCTAAGGTAATCAAAATAA
AATATTTTCACATTTTCAAGCTTATATTATTATGTAAAAGATTCAGTCAACAACTGATTA
AAGCAGTTAGAAACTACTAAAATAAATTCAAATAGACGAGGTTAATTAATCTCCAAATAA
TTCTAGCTAAACCACTCAAAAAGTAAAAGATGATCAAAATTCACATGTAAGTATATTAAA
TGATTTTCACAATTTAATCCTTTATTTATTTATTTATTCATTCATTCATTCATTCGTTTA
TTTTAAAGAAATAAGAAACTCAACTGAATCTACAAGAATAAAATAAATATGATGATATTA
AATAGATTGAAACACCAAAATCACCTATTAAAACAATTAAAAGTAATGACTTTTGTACTT
AATAAAATAATCTACCAGCTACAGTATACCTGAAAGATGTTGTATAATAAGAAGAAAAAA
AAATAGATATCAATAAAGAAAATATAAATGAAAATAATTAGATAAAATACGAAGAAATTT
AAATTACTAGAAGAATAACTGCAAAAGTAGTTAGTAAATGCAAAAAATAAGTCAGTGAAC
CAGAAAAATAAAACACTCAATGTGAAATAAAAACAAAATCGAACCCGAAATAGGCTGATG
AAACTCCAATTACTCCAATCAAATCAGATTAAAAAGATTTGAATACAGAATTAAATGGTA
ATTCTCAAGAACAAAAAAATCTATCTAAAACAAAAGAAAATATTTCTAAAGAATAAGAAT
TCAACAGTGCTGCTTCTTGCAAATTATTAACCGAAAAAAAAAATAATTTTGTAGCGTAAA
TTAACTGTGAAGAAAATTATTTAATTATTAATTTATTTATTATATCATAAAGTAAGGAGT
AATGTTAAGAGAAGAATTCTTAAGATCTATCTGAATAAAAAACTCAAAGTAAGTTGAATT
AAAAATAAATATTATAAATTTGTATTTCAGTTAATAAATTAAAATTACTTTATAAATAAA
TAAATAGAATAATCTTTAGGATAAATAATTGAAGAAGAGGATGAATTTGTTTCACAATCT
GTAATATACTTTTTAATTTTAAATTAAATTCTTTTCATAAAATAAAGAACAAAGAAAATT
ATATAATTCGCAGAATCTCCTTTGAAAGTGCTTTAAAATTATAAGATTAAGAAAACAACT
AAAATAAACAAACTCCTTAATAATTAAGCTTTTTTGAAAGTAAATAAAAAGATATTTAAT
TAATTTAGTTTAAATATTGAAATAGAATTAACCAAAATAAAAATATAAAAAAGAAAACTA
ACAAAATCTAACACCAGATTTACTTCAAAAAGAGTTGTTGGGTGAGAAATCTCAAAATAA
ATCAGATTATTAGAAAAGTAAACTCATATATAGTCATCTTAAACTAATTCATGATGAAAA
CTTGTATTATGATGATAAAAAATCCTATGACGGATATTATTATGAAGAAGATGAAGTAAA
AAAAAAATAAGAAGAAGAAGATGAAGAAAATATTTATATCATTCCAAGTAAATAATCAGA
ATAATTTAAAGTAATTTTTTCATCAAAATTCAAATTTATATTTATTTATATTAAATTCAT
AAATAAAGAAATAGAAGGTTAGTCTATTAAAAGACATGACGCAAGAGTAATTCTAACTAT
TTTTCAACATAGTAAGAAAGGAGGTAAAATTTAAATATATTTTAAAAAGAAGAAGAAATA
TTTCATATGATTTATTTATTAGTTTTTTTATTTATTTTAAAATAAGAACGATATTAGATA
TGTTTTATCCATCCTCATCATATACTCAAATATATTTTATTTTAAAATTAGATATAGAAT
GAAAGATTCATAAATGATACAACAAAGAACTAAATAAATATTTTATAAACATAGATTCCC
TAAGTTCAACTAGATAAATTGAATATTAAAATAAAATCATTTATTGATATTGTTAAGATA
GAAAACTCTGATTTATAGATTGAAAATTTTTGA


>TTHERM_00260780(protein)
MDQLFNCVNLPGGYVLKKKIGQGNYGQVYLVQSQRDGSILAIKNISTQNMIFEDLEKCLK
ECTILQKLDNPHIVKFKKAINQPNKQMIYIMMEYAEGGDLRKKIKEQKQTGKLFEEDQIL
DWFIQICLGLKYIHKNKIIHRDIKPENIFLTADNRVKIGDFGISKELEYTNQQLYSRIGT
PYYLAPEMIKGELYNSSVDIWSLGVVLYELCCLKPPFNSWNEYIIYYKTYKKPYPPITQA
QYSPQLKTLISKLLIKSPEGERGRYTLEQILNEPLIKNRLKQKFFQGRKQSPYEYFKDNN
NKNVNKIQQQHVQNNIIQENLIPTPAKFQNLQNKKQQLNDIMPNIYRAKDYSQEQFKNQS
VDMRKLNIFGQKEQSNLGKINEIMSCKPNFKKQSDIFDRNLSKQPVNDLTKQQKAYLSPN
IHLNRNQLKNNQQQGLNQLKQDNKQNTQFQKQILPNQKDLYTDIQLDQSPRQILKNKKKQ
GDVQYDLNKVEVANQNNNNKEEEEQNSKTKQDYEQTTQSQKQILPNQKDLYTDIQLDQSP
RQILKNKKKQGDVQYDLNKVEVANQNNNNDNNNNKEEEEQNSKTKQDYEQSTQSQKQILH
NQKDLHTNTQLYQRPLQILKNKKKQGDVQDLNKVQVTNLNNNNNKEEEEEQNSKTKQDYE
QSTQSQKQILPNQKDLHTDIQLDQSPLEILQNEKKQVDMQDLNKVEVTNQNNNKEEQNNK
TQSNLSIKSQKTFETNNSTYFFQQSNETYESDTIPAIQKNNLQNINLIDQVQNKTRLTYR
KKNKDSNEEDQKNKEPIFYQPNNQQQKLKNNESNDQDFKLEPKIQSTTDQSSQKLQKQTQ
IDEVFQSPNNSTQITQKGKDDQNYPVRITAKVVSKCKNQISEPEKQNTEFEIKTKSNPKQ
ADEIPITPIKPGQKDLNTELNDNSQEQKNLSKTKRNISKEQEFSTAASCKLITLNKEQSL
EKNSQDPYELKTHNQSLGQVIEEMEAKSNKDNQVNRRISFESALKLQDQENNSNKKTPQQ
FSFFDNNEQQLSPNLIQKELLDDTSQNKQEKIDNYFFEEIEEDICPYEQPEEESQNDMNT
RLTQLESKTDPSNLKDTNKDNQKNKLQDNYHQLIDDKSMHCDDKESDVEDSFYEEDQEEE
EEDDEEEDNIYIIPSKQSESFKKLKVSLLQDMDQEQFQLFSNIVKKEVEERTMQSRDLEF
NNFNIPESYLWIKQIGYGSQGQVHLIESKEDSSKLAIKNISTKNMSQQQKRKHQDEYRCL
QKLDHIVKFKKAIHCINNQMIQIIMEYTEGGDLQKAIEKQIQIGKPFEEEQILDWFAQIC
QGLKYIHENKIIHRDIKPANLFLTAQNTVKIGDFGVAKEQKYTNEQLSSQIGTPYYLAPE
IIDGKPYNSSVDIWSLGVVLYELCCLKPPFNSWCEAGLYYKSKNLPYPPIQAKYSKKLKE
LISKLLRKSPDDRYTLQEILDEPFIKNRLKKKSSSKDRQQSPNKFFNDNKNINSLQQNKK
VINILPVQNNIIQQNFIPNSAKYQNLQDKKQQLNDIRPNSCRAKKDYVQEQQQNESVDKT
KNLNILEKVNVPMSCKQNSQKQLDQFGQQEQSNFEKINLANKNQFGQQEQSNFEKINVPM
SCKQQSQKQQNKYILIKNPFIQQVNDLAKRQNTDSTSYFQLDRKLLKRYQQQGLNQLKQV
YEQRNQSLKQIFPNRKDINVLNKAEVTDDNNNNKEENNKTPATQSIKNIKTFKTQNSDYF
SGNSTQQSNETQESDKKSAIQKNNQGQIQSKRRLSQKIKNIARNEEDQKNKEAIFFQPNN
QQQKLNNNESNYQDFKLEPKKQETQLNLQEQNKYDDIKQIETPKSPIKTIKSNDFCTQQN
NLPATVYLKDVVQQEEKKIDINKENINENNQIKYEEIQITRRITAKVVSKCKKQVSEPEK
QNTQCEIKTKSNPKQADETPITPIKSDQKDLNTELNGNSQEQKNLSKTKENISKEQEFNS
AASCKLLTEKKNNFVAKEQCQEKNSQDLSEQKTQKQSLGQIIEEEDEFVSQSNKENYIIR
RISFESALKLQDQENNQNKQTPQQLSFFEKNQQNLTPDLLQKELLGEKSQNKSDYQKSKL
IYSHLKLIHDENLYYDDKKSYDGYYYEEDEVKKKQEEEDEENIYIIPSKQSEQFKKQKVS
LLKDMTQEQFQLFFNIVRKEIQNERFINDTTKNQINILQTQIPQVQLDKLNIKIKSFIDI
VKIENSDLQIENF