Identifiers and Description

Gene Model Identifier

TTHERM_00266390

Standard Name

RPS15 (Ribosomal Protein of the Small subunit 15)

Aliases

PreTt09773 | PreTt09774 | 24.m00369 | 3690.m00020

Description

RPS15 40S ribosomal protein S15; Homolog of yeast RPS15- human RPS15- bacterial RPS19

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06927.1 3.999413844471248e-84
Description: hypothetical protein (165 aa)
SGD YOL040C 4.9981275274605926e-36
Description: RPS15 Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S19 and rat S15 ribosomal proteins
WormBase WBGene00004484 2.0008113830639685e-30
Description: locus:rps-15 40S ribosomal protein S15 status:Confirmed UniProt:Q9XVP0 protein_id:CAB03065.1
Oxytricha Contig7529.0.g65 3.000555717977434e-27
Description: Ribosomal protein S19
DictyBase DDB_G0285561 9.003625457657353e-25
Description: rps15 on chromosome: 4 position 3385002 to 3385755
Stentor Coeruleus SteCoe_35365 3.1391327920480296e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00266390(coding)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCATTCCTGAATTAGTCGGTGGTATCGTCGGT
GTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGGTAAATAT
CTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGCTGCCGGT
GGTAAGGGTAAGTGA


>TTHERM_00266390(gene)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCAGTAAGAAAGCGTTTTTTATAGAATAATTC
AATCAAAGGTGATTTAGGAGAGATCGAAATCTGTCTAAATTTTTCATTAAATTTCTTCAG
TTCTTTTTGATTTTAGTAAAGTGTGTTTGTTTATCACAGTATCTTTTAAGTACTCTTTTA
CTGCTGCTTTAAAGAGAAATTGCTCGTGATTCCTTCCTTAAAATTTCAACATAAGTTGAA
GGCTTCCCTCTTTTAGGAATTAATATTTAGGTAAAAAAATGCTTGGTGCTTTAGGATGAA
TCGAAAAGTAAAAAAGGTGTATTGTAACAACATTAAGACTGAACATTTTTAAGCATATTA
TTGGGAATTTTTTAAGTGAAGGATAGATAATATTAATTTAGAAATGAGAAATATCTCTTC
AACAAAAAGCAAAAATTAAGTCAATTAACTACTAATTTTAGGGACTAATTTAATCAATCA
ATCACAGCACTTGATTAAAACTGAAATAATACATACATACGACATTCAATTAATAATTGA
ACTAGTTGTTGATTAGAAGTTTCAAAAAAATTGACTTATTTACTTACTTTCTTTCACATC
CTCAATAAGGATGGATGGTTTTTGCAGAATTCACTTTTTGTTTACAAATAGTGAATAAAG
ATAGAAAGAACTGCACCAGCTGATTCTAAAATTAATTAATTTAGACCAGCAAATCAGTTT
CACCATCATCTATCTATCCCAATAACTTTGCAGTTCAGATGATAAGTGTTACTACCCTTT
TTTAAAAAAATATTTACAAAGTAGATTTCATTTTAGAGCATGCAAGTAGGACCACCTAAT
TTAAAAGGAGGACAAAAGCAGATAGGAGCGAATCAGGAATATAGCCTTTTATAGGCTGAG
CGAGCAAGTTTAATTTATTAGCAACAAGAGAGAGTGTAAAAAAGTAATATATAAATTATG
AAAATAATTTTATATTTACTAATCCAACAACCATACTATATTAATCAATTAGCCTTCAAA
TAAAAAAACTTTAAAATTAAATGACAAAGTATTTATTATTCAAATAATTACTTTGTTAAG
AAGGATAAAAAAATTTATTTTCTAAATCACCTATTAATTATTTTAATCTTTATTTGAAAA
TTAATTTTTGTTGCTAATCCACTATTATTTATTAAAAGTTCCTGAATTAGTCGGTGGTAT
CGTCGGTGTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGG
TAAATATCTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGC
TGCCGGTGGTAAGGGTAAGTGA


>TTHERM_00266390(protein)
MADNKKSIKKFTFRGKGLEELTALASGSNSEKLISDELAALFDAKTRRRVKRGISEKYAK
FVNKVRRSKEKCPAGEKPVPVKTHYRSMIVIPELVGGIVGVYNGKEFVNVEVKFDMIGKY
LAEFAMTYKPTTHGKTGAAGGKGK