Identifiers and Description

Gene Model Identifier

TTHERM_00267860

Standard Name

CDK13 (Cyclin Dependent Kinase 13)

Aliases

PreTt09821 | 24.m00252 | 3690.m00066

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Rck kinase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF00357 ) Integrin alpha cytoplasmic region
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06888.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (683 aa)
Oxytricha Contig15886.0.g14 3.000551941601253e-121
Description: Protein kinase domain
DictyBase DDB_G0268078 4.999984259728227e-105
Description: DDB_G0268078 on chromosome: 1 position 1417972 to 1419590
WormBase WBGene00001121 1.0002646133906571e-103
Description: locus:dyf-5 status:Confirmed UniProt:B3WFY8 protein_id:CAQ76489.2
SGD YBR160W 2.9997246065828143e-59
Description: CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates
Stentor Coeruleus SteCoe_22820 7.667648073722e-53
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00267860(coding)
ATGAATATATTCATTAAAATTATTAATTAAATAGAGAGCAAATAAAGAAAAAAAGTTAAT
AAGAAATCAATTATTAAATTAATTAATTTTCTAAATAAGTTTAAATAGTTAAATATTAAA
AAAGAAATATTCAAAATGGAAAAATATAATATAATTAGCGAGATTGGAAGAGGTGCTTTC
GGTATCGTTAAGAAAGCTTAAAATAAGGAAACGAAGGAAATTGTGGCTATTAAGTAAATG
TTGTAGGAGTATGAGACATGGGACGAGTGCATTAATTTAAGGGAATTGAAATCACTTAGG
AAATTGACACACGTGAATATCATAAAACTCAAAGAAGTGTTTCGCGTCAAGAAACAGCTT
TCGTTTGTTTTTGAATATGTTGAAAAGAATATATATAAACTATATGAAAATGCAAAGCAA
GATGGAGCAACATCCCTGCCAGAAAACACAATAAAAAGCATAGTTTATTAAATTGCCTCT
GCACTTTCATATATGCATAAACATGGTTTTTTCCACCGTGATTTGAAGCCAGAAAATCTC
CTGATCTCAAGCGATGGGATTGTAAAGTTGATTGACTTCGGATTAGCTCGTGAAGTGCGT
TCTCGTCCTCCATACACTGATTATGTTTCTACTAGATGGTATAGAGCACCCGAAATATTA
CTACGCTCTACTCATTATAATAGTCCAGTCGACATTTTCGCTTTAGGTTGCATCATGGCA
GAGTTATATTTAATGAAGCCGCTTTTCAACGGTTCTTCTGAAATAGATCAGATATAAAAA
ATAACTTCAGTTTTAGGCACTCCCCAAAAATAGGATTGGCCTGATGGGTTTATTTTAGCC
TCAACAAAGTATTATACTTTCCCTTAGTACCCAGCGATTCCTTTATCACAAGTTATTCCA
AATTGTCCTCCTGATGCACTTAATTTAATCTCAGAAATGCTTAAATGGGATCCATAAAAA
AGAATAACTGCTGCCAAGATACTTTAGCATCCATATTTTAGCAATGTAGAATTACCAGAA
GAATTAACAGCTGAAAGCAATAGCAATTAAATGATACAATCCTCTAATTAGCCAGCAACT
TTATTAGGGGGTGCCAGTTCAAACAATGCAGAGTCAGTTTGGAATCAGAGTGGCAACAAT
AATGCAAATCTAAACCAATTTTAAGGAAATGTAAATGCAAGTTAAAATGTTCCTGCAAAT
TCTCGTTTGGGTGGTCATTCTAATACAGCAAATTAAAACTCAAGCTAGTTTGGATTGAGC
AGTATTAATAGCACAAGTAGCTACCATCTAGGCAATTACAACAATCATTAGCGTTAACTT
TCACCTCAAACAAATTATGATAACAATTCTTTGAATACAATTAAACATGGACATGGTCAT
TTCCATTACTAAAGTAGCAGTCCTGATAACAGATATACTTAATCAAATAATCAAAGATCT
TAGACAGACTTAATTGGTCTTAAAAACAATTTTGAACTAAATTAATAATTATAGAGATAA
TAGTAATTCAGTAATCAAAACTAAAATTAGATCTCAAAGAAATAATTTGATCCAATTTAT
GAGTTCTTAAATAATGATGTTAGAACAATAAACAATCCAAACACAGGATCTATATCAACA
ACAAATAATGTCAACAGCATTGCAAGCAATAATAATAACAACAACAATAATAATTTAGGA
GGATAAATTATTAATCCATTAGAAAAAGGGTCTCGCTTTAGTGTGCCATAAGGAATAAGT
TCAAAAAATATGATAGATGATGAAATCGAAGATATGGAATAAGAAATATTAGGTACATAC
TTACCAACAGGAGGCAATGTTTCAAGAGTTCGTAACAGCAATAATAACAATACCCTTTCT
TAAAACAATAATGGTAGCACTCTTTTTGGAAATAACTAGGAAAACCAAGCAAGTATGTTC
TCTAACCCAAGAGGAGGAAATAGGGATAGAAATGTTAAAGATAATACTCTTAGTAATTAG
GATTCAAATACATTAGGATATGTTCCATCGGCTATTGCCAGAAATCAGCCTTCAAATCTA
GATATTTATAGGTTTGACCCTAAACCTCAAGCAAATACATATAATCCCAGTTTTGCTGCA
AATAATAATATGAACAATGGCAGTAAAATAAATAATGATATATATAATTTTGACAATGTA
ATTACAAATAACAGAAAAATTCAATTACCTCAATGA


>TTHERM_00267860(gene)
ATGAATATATTCATTAAAATTATTAATTAAATAGAGAGCAAATAAAGAAAAAAAGTTAAT
AAGAAATCAATTATTAAATTAATTAATTTTCTAAATAAGTTTAAATAGTTAAATATTAAA
AAAGAAATATTCAAAATGGAAAAATATAATATAATTAGCGAGATTGGAAGAGGTGCTTTC
GGTATCGTTAAGAAAGCTTAAAATAAGGAAACGAAGGAAATTGTGGCTATTAAGTAAATG
TTGTAGGAGTATGAGACATGGGACGAGTGCATTAATTTAAGGGAATTGAAATCACTTAGG
AAATTGACACACGTGAATATCATAAAACTCAAAGAAGTGTTTCGCGTCAAGAAACAGCTT
TCGTTTGTTTTTGAATATGTTGAAAAGAATATATATAAACTATATGAAAATGCAAAGCAA
GATGGAGCAACATCCCTGCCAGAAAACACAATAAAAAGCATAGTTTATTAAATTGCCTCT
GCACTTTCATATATGCATAAACATGGTTTTTTCCACCGTGATTTGAAGCCAGAAAATCTC
CTGATCTCAAGCGATGGGATTGTAAAGTTGATTGACTTCGGATTAGCTCGTGAAGTGCGT
TCTCGTCCTCCATACACTGATTATGTTTCTACTAGATGGTATAGAGCACCCGAAATATTA
CTACGCTCTACTCATTATAATAGTCCAGTCGACATTTTCGCTTTAGGTTGCATCATGGCA
GAGTTATATTTAATGAAGCCGCTTTTCAACGGTTCTTCTGAAATAGATCAGATATAAAAA
ATAACTTCAGTTTTAGGCACTCCCCAAAAATAGGATTGGCCTGATGGGTTTATTTTAGCC
TCAACAAAGTATTATACTTTCCCTTAGTACCCAGCGATTCCTTTATCACAAGTTATTCCA
AATTGTCCTCCTGATGCACTTAATTTAATCTCAGAAATGCTTAAATGGGATCCATAAAAA
AGAATAACTGCTGCCAAGATACTTTAGCATCCATATTTTAGCAATGTAGAATTACCAGAA
GAATTAACAGCTGAAAGCAATAGCAATTAAATGATACAATCCTCTAATTAGCCAGCAACT
TTATTAGGGGGTGCCAGTTCAAACAATGCAGAGTCAGTTTGGAATCAGAGTGGCAACAAT
AATGCAAATCTAAACCAATTTTAAGGAAATGTAAATGCAAGTTAAAATGTTCCTGCAAAT
TCTCGTTTGGGTGGTCATTCTAATACAGCAAATTAAAACTCAAGCTAGTTTGGATTGAGC
AGTATTAATAGCACAAGTAGCTACCATCTAGGCAATTACAACAATCATTAGCGTTAACTT
TCACCTCAAACAAATTATGATAACAATTCTTTGAATACAATTAAACATGGACATGGTCAT
TTCCATTACTAAAGTAGCAGTCCTGATAACAGATATACTTAATCGTAATTTATTTATAAA
CTTTAAAAAATGTTTTATTCAAAATTCAAAGCAAATCAATAATAATGTTTGCTAATTAAT
TTTTATACATTCAATAAAGATAACTTAAAAATTAAATTCAAGCAATCAATCAAACAAACA
AACAAAATCAAATTTTCTTAAAGTAGTCAAGTTAAAGTCAGTCATTTTGCAAATATAAAC
GAAATTAAATTACAATCAATAATTAATTTCTTAACAAATACTAAAAACACCTATGTTGGT
TTTTGACTACTTAGTGCCTGCACAAACAAGATCTTTTTTTCAATAGATTGATTATTAAAT
TATTTTGATCCAGCAATTTGTCCATCCTGAAAAATTTTTACCAGCAAAATAATAAATTTA
TTATAAAATAAACTTCATAGATAAATTCCTAACTAAAATTTTAATTTTTAAGAAAATTTA
ACATTTTGTTAATGTTTTTGAATAAAATCAATTAAATTAGTTATTTCCTTTTTGAAGATA
GTTTAGAAGTAAAAATATTTAATATATTATTTAAAATAATAGAAATAATCAAAGATCTTA
GACAGACTTAATTGGTCTTAAAAACAATTTTGAACTAAATTAATAATTATAGAGATAATA
GTAATTCAGTAATCAAAACTAAAATTAGATCTCAAAGAAATAATTTGATCCAATTTATGA
GTTCTTAAATAATGATGTTAGAACAATAAACAATCCAAACACAGGATCTATATCAACAAC
AAATAATGTCAACAGCATTGCAAGCAATAATAATAACAACAACAATAATAATTTAGGAGG
ATAAATTATTAATCCATTAGAAAAAGGGTCTCGCTTTAGTGTGCCATAAGGAATAAGTTC
AAAAAATATGATAGATGATGAAATCGAAGATATGGAATAAGAAATATTAGGTACATACTT
ACCAACAGGAGGCAATGTTTCAAGAGTTCGTAACAGCAATAATAACAATACCCTTTCTTA
AAACAATAATGGTAGCACTCTTTTTGGAAATAACTAGGAAAACCAAGCAAGTATGTTCTC
TAACCCAAGAGGAGGAAATAGGGATAGAAATGTTAAAGATAATACTCTTAGTAATTAGGA
TTCAAATACATTAGGATATGTTCCATCGGCTATTGCCAGAAATCAGCCTTCAAATCTAGA
TATTTATAGGTTTGACCCTAAACCTCAAGCAAATACATATAATCCCAGTTTTGCTGCAAA
TAATAATATGAACAATGGCAGTAAAATAAATAATGATATATATAATTTTGACAATGTAAT
TACAAATAACAGAAAAATTCAATTACCTCAATGA


>TTHERM_00267860(protein)
MNIFIKIINQIESKQRKKVNKKSIIKLINFLNKFKQLNIKKEIFKMEKYNIISEIGRGAF
GIVKKAQNKETKEIVAIKQMLQEYETWDECINLRELKSLRKLTHVNIIKLKEVFRVKKQL
SFVFEYVEKNIYKLYENAKQDGATSLPENTIKSIVYQIASALSYMHKHGFFHRDLKPENL
LISSDGIVKLIDFGLAREVRSRPPYTDYVSTRWYRAPEILLRSTHYNSPVDIFALGCIMA
ELYLMKPLFNGSSEIDQIQKITSVLGTPQKQDWPDGFILASTKYYTFPQYPAIPLSQVIP
NCPPDALNLISEMLKWDPQKRITAAKILQHPYFSNVELPEELTAESNSNQMIQSSNQPAT
LLGGASSNNAESVWNQSGNNNANLNQFQGNVNASQNVPANSRLGGHSNTANQNSSQFGLS
SINSTSSYHLGNYNNHQRQLSPQTNYDNNSLNTIKHGHGHFHYQSSSPDNRYTQSNNQRS
QTDLIGLKNNFELNQQLQRQQQFSNQNQNQISKKQFDPIYEFLNNDVRTINNPNTGSIST
TNNVNSIASNNNNNNNNNLGGQIINPLEKGSRFSVPQGISSKNMIDDEIEDMEQEILGTY
LPTGGNVSRVRNSNNNNTLSQNNNGSTLFGNNQENQASMFSNPRGGNRDRNVKDNTLSNQ
DSNTLGYVPSAIARNQPSNLDIYRFDPKPQANTYNPSFAANNNMNNGSKINNDIYNFDNV
ITNNRKIQLPQ