Identifiers and Description

Gene Model Identifier

TTHERM_00267990

Standard Name

RPN8 (26S proteasome regulatory subunit N8)

Aliases

PreTt09834 | 24.m00265 | 3690.m00079

Description

RPN8 26S proteasome regulatory particle non-ATPase subunit; Mov34/MPN/PAD-1 family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01398 ) Mov34/MPN/PAD-1 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06880.1 9.997093137033517e-262
Description: Mov34/MPN/PAD-1 family protein (328 aa)
Oxytricha Contig11141.0.g37 1.0000198575659891e-106
Description: Maintenance of mitochondrial structure and function
DictyBase DDB_G0279633 8.998157708876845e-106
Description: psmD7 on chromosome: 3 position 2343459 to 2344670
WormBase WBGene00004464 7.997650503635949e-84
Description: locus:rpn-8 status:Confirmed UniProt:O61792 protein_id:CCD65169.1
SGD YOR261C 8.999979922762958e-79
Description: RPN8 Essential, non-ATPase regulatory subunit of the 26S proteasome; has similarity to the human p40 proteasomal subunit and to another S. cerevisiae regulatory subunit, Rpn11p
Stentor Coeruleus SteCoe_28804 2.506567475899953e-46
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00267990(coding)
ATGTCTGGATAATCTGCAAATCTTTCCCATTTACCAAAATTAGTAGCTGTTCACCCTCTA
GTTTTGTTATCTGTAGTTGATCACTTTAACAGAGTTGCAAAATCAAGCAAAAATAAGCGT
GTAGTTGGTGTTTTGCTTGGTTAAAAATCTCAAGGAAAAGCTGATGTTACTAATTGCTAT
GCAATTCCTTTTGATGAAGATCCAAAGCAACCAAATATATGGTTTGTTGATCACATTTAT
CACGAAACCATGTTTAACATGTTCAAAAAGGTCAATGCCAGAGAAAAAGTTTTAGGATGG
TACACAACTGGAAAGCATTTTAAGCAACATGATATTCAAATTAATGAAGTATTCAAGAAA
TACTGCCCTAATCCTATCCTTTTGATTGTAGATGTTTAGCATGAAGATAAACTTGCTTTG
CCTACTGAAACTTATTGTGCTGTTGAAGAAGTCTCAAAGAACGGTGAAATAATTTAAAAT
TTTGTTCATCTCCCCTCAACTGTAGAAGCTTTCGAACCAGAAGAAATAGGTGTTGAGCAT
CTTTTAAGAGAAATTAGAGATGTCTCAGTTAACACTTTAACAAACCAAGTTACAGATAAA
ATTTAAGCATTAAAGGGTATGATGGGAAAAATTTAATAAATTAAACTCTACATAGAAGCC
GTTCTTGGAGGTAAAGTTCAAGCAAAGAATGATATCCTCTTTAAGATATAAGAAATATTG
AACTTACTACCTAACTTAAATAATCCAGAAATAATTAAATCATTTGCTTCCAAAAATAAT
GATTAAATGTTTGTCTTATATATATGCTCCTTATCTAAATCAATTATTTCTCTCCACTCT
CTCATCAACAACAAATTATAAAATAAAGAAGCTGAGTTAGAAAAACTTAGAGAAGCAGAC
AAAAAAGTTGATGAAAAGAAAGAAGGAAATAGCACTGCTGCAGCTGGTGCTGAAAAAAAA
GAAGAAAAGAAATGA


>TTHERM_00267990(gene)
ATGTCTGGATAATCTGCAAATCTTTCCCATTTACCAAAATTAGTAGCTGTTCACCCTCTA
GTTTTGTTATCTGTAGTTGATCACTTTAACAGAGTTGCAAAATCAAGCAAAAATAAGCGT
GTAGTTGGTGTTTTGCTTGGTAATTACAAAACTTAGATTTATTAAATATGAGATTAATAT
AAATTTTATAAATACGCTCATTTCACATTTAAGATAACAATTATTTAAATAATTCACAGG
TTAAAAATCTCAAGGAAAAGCTGATGTTACTAATTGCTATGCAATTCCTTTTGATGAAGA
TCCAAAGCAACCAAATATATGGTTTGTTGATCACATTTATCACGAAACCATGTTTAACAT
GTTCAAAAAGGTAATTTAATTATATGCCCTTTAATGGAAACTTTTAATTTTGACAAAAAA
TTAATATTCTAAGAGCGTTTTTTAAAACAATTTTAAATTTGCTTCATTGAATAAAAAATT
ATGAGAAATATTTTTAAACGTTTTTTACTAATAAATAATAATAATAAACTTAAATAATAA
AAGGTCAATGCCAGAGAAAAAGTTTTAGGATGGTACACAACTGGAAAGCATTTTAAGCAA
CATGATATTCAAATTAATGAAGTATTCAAGAAATACTGCCCTAATCCTATCCTTTTGATT
GTAGATGTTTAGCATGAAGTAAAAATTATATTTACTATTTCAATAGCATATTTTAGATTA
GAAAAAATGCTTAATTATAATTGAATATTGGTACAATGTGCTAAGTAGAATTTCTTTTCG
AACAAATTATTAAGACAATATTAACTAAGAAGAAAAGAAGTTTTTCTTTTTGCATTAAGT
TTTTATTAGCTAGCAAATGATATTTAAAAGATTAAACTTTATAAAATATGATAGAATATA
TAAAAAGCAATTAAAATTTATGAAAGTTTATTTCTTATAAATAAAAAATAAATAATTTAA
TATTAAAAATAAAGGATAAACTTGCTTTGCCTACTGAAACTTATTGTGCTGTTGAAGAAG
TCTCAAAGAACGGTGAAATAATTTAAAATTTTGTTCATCTCCCCTCAACTGTAGAAGCTT
TCGAACCAGAAGAAATAGGTGTTGAGCATCTTTTAAGAGAAATTAGAGATGTCTCAGTTA
ACACTTTAACAAACCAAGTAAGCATTTATTTATTAGTAAATGATAGCATCGATAAATAAT
AAAAAAAATTAAAAATAGGTTACAGATAAAATTTAAGCATTAAAGGGTATGATGGGAAAA
ATTTAATAAATTAAACTCTACATAGAAGCCGTTCTTGGAGGTAAAGTTCAAGCAAAGAAT
GATATCCTCTTTAAGATATAAGAAATATTGAACTTACTACCTAACTTAAATAATCCAGAA
ATAATTAAATCATTTGCTTCCAAAAATAATGATTAAATGTTTGTCTTATATATATGCTCC
TTATCTAAATCAATTATTTCTCTCCACTCTCTCATCAACAACAAATTATAAAATAAAGAA
GCTGAGTTAGAAAAACTTAGAGAAGCAGACAAAAAAGTTGATGAAAAGAAAGAAGGAAAT
AGCACTGCTGCAGCTGGTGCTGAAAAAAAAGAAGAAAAGAAATGA


>TTHERM_00267990(protein)
MSGQSANLSHLPKLVAVHPLVLLSVVDHFNRVAKSSKNKRVVGVLLGQKSQGKADVTNCY
AIPFDEDPKQPNIWFVDHIYHETMFNMFKKVNAREKVLGWYTTGKHFKQHDIQINEVFKK
YCPNPILLIVDVQHEDKLALPTETYCAVEEVSKNGEIIQNFVHLPSTVEAFEPEEIGVEH
LLREIRDVSVNTLTNQVTDKIQALKGMMGKIQQIKLYIEAVLGGKVQAKNDILFKIQEIL
NLLPNLNNPEIIKSFASKNNDQMFVLYICSLSKSIISLHSLINNKLQNKEAELEKLREAD
KKVDEKKEGNSTAAAGAEKKEEKK