Identifiers and Description

Gene Model Identifier

TTHERM_00268050

Standard Name

CTH82 (CaTHepsin 82)

Aliases

PreTt09840 | 24.m00271 | 3690.m00085

Description

CTH82 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08194 ) DIM protein
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06873.1 1.0004659174935984e-170
Description: papain family cysteine protease containing protein (320 aa)
Oxytricha Contig16089.0.g2 2.0009381340492598e-66
Description: Papain family cysteine protease
WormBase WBGene00000776 3.000745802558524e-63
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
DictyBase DDB_G0272815 6.9972728945133496e-59
Description: cprE on chromosome: 2 position 2212329 to 2213613
Stentor Coeruleus SteCoe_5044 8.985825944049381e-37
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00268050(coding)
ATGAACAAATACTTATTACTTGCTTTAGCTGGTACCATCCTCTTAGGTGCTACTGCTTTC
TTGGTTGCCAAGAAACATTCAACTGAAGTTAAGATCAATGAAGATGTTTAAACTTAATGG
AAGATGTTCAAGAAGACTTTCGGTAAGAAGTTCGCTGATCCCGAGTAAGAACACTACAGA
ATTGAAATTTTTGCTGAAAACCTCGAAACCATTAAGAACGATAAGACTGGTACTTTGGGT
ATCACTCAATTCGCTGATCTCTCTCATGAAGAATTCAAGAGCATCTACCTTACTTTGTAA
GTTGAATCTTCTGAAGTTAAGACCGTTGAATACGAAGTTGCTGCTGATGATGTTTCAATC
AACTGGGTTACTGCTGGTAAGGTCACTGCTGTTAAGAACTAAGGTAATTGTGGTTCATGT
TGGTCTTTCTCTACCACTGGTTCTTTCGAATCTGCTCTCATCATTGCTAACAAGGCTAAC
AATACCCTCAATCTTTCTGAATAACAATTGATTGATTGCTCCTATTTGAACCACGGTTGC
AACGGTGGTTTAATGGACAAGGCTTTCACCTACATCAAGAACCACAATCTTACTACTGAA
GCTGAATATCCTTATTAAGCTAAATAGGGTAAATGCCAAAAGGTTACTGGTACTTAGTAC
TCTCTTTAGAGCTACACTGATGTTAAGCAAGGTGATATTCAAGATCTTTTAAATTCTCTC
CAAAAGCAACCTGTTGCCATTGCTGTTGATGCTAATAACTGGAAATTATACACTGGTGGT
GTCTTCTCTAACTGCGGTACTAGTCTTGATCACGGTGTCCTCCTCGTTGGTTATGAAAAC
AACGCTTGGATCGTCAAGAACTCCTGGGGTACCACATGGGGTGAAAAAGGTTACATTAGA
CTTGCTAGCGGAAACACTTGCGGTCTTGCTAACAATGCTTCTTATCCCAACGTTTGA


>TTHERM_00268050(gene)
ATGAACAAATACTTATTACTTGCTTTAGCTGGTACCATCCTCTTAGGTGCTACTGCTTTC
TTGGTTGCCAAGAAACATTCAACTGAAGTTAAGATCAATGAAGATGTTTAAACTTAATGG
AAGATGTTCAAGAAGACTTTCGGTAAGAAGTTCGCTGATCCCGAGTAAGAACACTACAGA
ATTGAAATTTTTGCTGAAAACCTCGAAACCATTAAGAACGATAAGACTGGTACTTTGGGT
ATCACTCAATTCGCTGATCTCTCTCATGAAGAATTCAAGAGCATCTACCTTACTTTGTAA
GTTGAATCTTCTGAAGTTAAGACCGTTGAATACGAAGTTGCTGCTGATGATGTTTCAATC
AACTGGGTTACTGCTGGTAAGGTCACTGCTGTTAAGAACTAAGGTAATTGTGGTTCATGT
TGGTCTTTCTCTACCACTGGTTCTTTCGAATCTGCTCTCATCATTGCTAACAAGGCTAAC
AATACCCTCAATCTTTCTGAATAACAATTGATTGATTGCTCCTATTTGAACCACGGTTGC
AACGGTGGTTTAATGGACAAGGCTTTCACCTACATCAAGAACCACAATCTTACTACTGAA
GCTGAATATCCTTATTAAGCTAAATAGGGTAAATGCCAAAAGGTTACTGGTACTTAGTAC
TCTCTTTAGAGCTACACTGATGTTAAGCAAGGTGATATTCAAGATCTTTTAAATTCTCTC
CAAAAGCAACCTGTTGCCATTGCTGTTGATGCTAATAACTGGAAATTATACACTGGTGGT
GTCTTCTCTAACTGCGGTACTAGTCTTGATCACGGTGTCCTCCTCGTTGGTTATGAAAAC
AACGCTTGGATCGTCAAGAACTCCTGGGGTACCACATGGGGTGAAAAAGGTTACATTAGA
CTTGCTAGCGGAAACACTTGCGGTCTTGCTAACAATGCTTCTTATCCCAACGTTTGA


>TTHERM_00268050(protein)
MNKYLLLALAGTILLGATAFLVAKKHSTEVKINEDVQTQWKMFKKTFGKKFADPEQEHYR
IEIFAENLETIKNDKTGTLGITQFADLSHEEFKSIYLTLQVESSEVKTVEYEVAADDVSI
NWVTAGKVTAVKNQGNCGSCWSFSTTGSFESALIIANKANNTLNLSEQQLIDCSYLNHGC
NGGLMDKAFTYIKNHNLTTEAEYPYQAKQGKCQKVTGTQYSLQSYTDVKQGDIQDLLNSL
QKQPVAIAVDANNWKLYTGGVFSNCGTSLDHGVLLVGYENNAWIVKNSWGTTWGEKGYIR
LASGNTCGLANNASYPNV