Identifiers and Description

Gene Model Identifier

TTHERM_00274620

Standard Name

GST22 (Glutathione S-transferase mu 22, TtGSTm22, GSTm22)

Aliases

PreTt09902 | 24.m00333 | 3690.m00143

Description

GST22 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03489.1 4.001456298413176e-90
Description: glutathione S-transferase domain-containing protein (203 aa)
Oxytricha Contig12816.0.g91 7.002638123733849e-21
Description: Glutathione S-transferase, N-terminal domain
Stentor Coeruleus SteCoe_29804 0.000000005602796437537268
Description: None
DictyBase DDB_G0274081 0.000000007998594485613997
Description: DDB_G0274081 on chromosome: 2 position 3748941 to 3749724
WormBase WBGene00001787 0.000009999254677478949
Description: locus:gst-39 status:Confirmed UniProt:Q9NAB0 protein_id:CAB61107.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00274620(coding)
ATGTCTTAAAAAATCACTATTGGATATTGGAAAGGCCCTGGTAAGGTTTAACCTTCTAGA
TATTTACTTGAGATTTCTGGTGTTGAATATTAAGAAACCTTATACACTGATCCTGCTTAG
TGGTTTGGAAAAGATAAATACTCTCTAGACTTGCCTTTCCCAAATTTACCCTATCTGATT
GATGGAGATGTGAAACTAACAGAAAGTGAAACTATATTCGATTATTTAGTGAATAAACTG
AATATGAGCGAACTTTTAGGCAAAGAGTCAGATAGATTCATAGTTGATAATCTAAGGAAT
ATCTTCTCTGATCTTTGTACCAGCCTCTTTCAAGTATTTTAAAAATAAGGAGAAGAAAAA
TTAAAGATATTTAATTGCTAAATCCTACCTAAAGCTAACGACATTCACAAATTCCTCAAG
AATAAAGAATATTTGCTAGGATACTTTACAGTTGCAGATCTTTACTTTTTAAGTTTTGCT
AGAAATTTCAAAAGCTTTATGCCAGAACAATATGAAGAATTTGCAGGAACCTTTGATGCT
CTTAAAGAAAAGATTGAGTCAATCCCATAAATTGCATCTTATATTTCTGAAGGACGTCAT
CCAATTTTATGA


>TTHERM_00274620(gene)
ATGTCTTAAAAAATCACTATTGGATATTGGAAAGGCCCTGGTAAGGTTTAACCTTCTAGA
TATTTACTTGAGATTTCTGGTGTTGAATATTAAGAAACCTTATACACTGATCCTGCTTAG
TGGTTTGGAAAAGATAAATACTCTCTAGACTTGCCTTTCCCAAATTTACCCTATCTGATT
GATGGAGATGTGAAACTAACAGAAAGTGAAACTATATTCGATTATTTAGTGAATAAACTG
AATATGAGCGAACTTTTAGGCAAAGAGTCAGATAGATTCATAGTTGATAATCTAAGGAAT
ATCTTCTCTGATCTTTGTACCAGCCTCTTTCAAGTATTTTAAAAATAAGGAGAAGAAAAA
TTAAAGATATTTAATTGCTAAATCCTACCTAAAGCTAACGACATTCACAAATTCCTCAAG
AATAAAGAATATTTGCTAGGATACTTTACAGTTGCAGATCTTTACTTTTTAAGTTTTGCT
AGAAATTTCAAAAGCTTTATGCCAGAACAATATGAAGAATTTGCAGGAACCTTTGATGCT
CTTAAAGAAAAGATTGAGTCAATCCCATAAATTGCATCTTATATTTCTGAAGGACGTCAT
CCAATTTTATGA


>TTHERM_00274620(protein)
MSQKITIGYWKGPGKVQPSRYLLEISGVEYQETLYTDPAQWFGKDKYSLDLPFPNLPYLI
DGDVKLTESETIFDYLVNKLNMSELLGKESDRFIVDNLRNIFSDLCTSLFQVFQKQGEEK
LKIFNCQILPKANDIHKFLKNKEYLLGYFTVADLYFLSFARNFKSFMPEQYEEFAGTFDA
LKEKIESIPQIASYISEGRHPIL