Identifiers and Description

Gene Model Identifier

TTHERM_00277360

Standard Name

MRNC14 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt04779 | 25.m00243 | 3694.m00030

Description

kinase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08893.1 1.0001999920370885e-161
Description: hypothetical protein (368 aa)
Oxytricha Contig17269.0.g78 3.0007793728221555e-22
Description: MORN repeat
DictyBase DDB_G0349488 0.000000100009565553302
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00277360(coding)
ATGGGTATAGTTAATTCATGTGAGAAATCTACAAGACAAGTCGATAATGAAGTCTATTTG
AACGCGACTGGCGGAAGTCAATGTAGCAATAGAAAAACTCTTTAGCAGACCAGCACACTC
TAAACTCAAGGTTAAAACAAAGAAAATCAAGCTAAATAACCAACTAATAAGTCAAACTCT
TACCTTAAGTAGCATTAGGAAAATATTTCGCCAATATAAGAATTAACAACAGAAGAATCA
AAGAATAGCAAGTCTGCTTATTCTAAAATGTTTGACAAAGGATTAATTGAAAGCAACGCT
TTAAAAGTTCTAAAAATTGAATAAAATGAAACAAAATTACTCAACTCGATGTACTCAAAT
AATCTTTTGAATTCAACTGCTCTATATGACTGCTAAAGAAATAGATCATCATATTCTTAA
CATGTTGTAGGAAGTGTCTAGAGCAATTTACTATAACAGAATAACTCATATATGAATTGC
AGTCAGGCACAATTTATTGAAAAAGAAGGTATTAAATCAAGTAGACCTTCTCTCAATTAA
TAGAGTATGACAAGATCAACACATTCTACTTCCCTTTATGTTGCAAATGAGAGGAAGAGA
GTCAAAGAGATATACGAAGATGGTTCTGTCTATGAAGGTCAAGTATTAAATGGATTGAGG
GATGGGTAAGGCACATTCACTTACTCAAATTAAGGAGCTAAGTATGTAGGCTAATGGCTT
AAAGGTAACATCGAAGGATATGGCATACTTTTTTTCTCTGACAACAGAGTTGCATACGAA
GGCCAATGGAGAGAAAATAAATTCAATGGGAACGGAGTCGTATACAATGAAAACCATTCA
AAAAGGTAAAGTAAAATAGTTGGTTTCGACTATAAAAGTTTTGACAATATTGAAGAAGAA
TGGTTTAAGTATGATGGAAACTTTGTAGATGATCAAAAAGATGGACTTGGAACTCTATAC
CTAAAAAACGGTGAGAAATTTGTGGGAAACTTCCACAAAGATGCTGTGAATGGCAATGGA
GCATTTTATTTGATTGACGGTACAATAATCTTAGGAGTTTGGGACAATAATAATTTAGTT
CAAGAAACAACAAGAATTAAAAGTTGTTGA


>TTHERM_00277360(gene)
ATGGGTATAGTTAATTCATGTGAGAAATCTACAAGACAAGTCGATAATGAAGTCTATTTG
AACGCGACTGGCGGAAGTCAATGTAGCAATAGAAAAACTCTTTAGCAGACCAGCACACTC
TAAACTCAAGGTTAAAACAAAGAAAATCAAGCTAAATAACCAACTAATAAGTCAAACTCT
TACCTTAAGTAGCATTAGGAAAATATTTCGCCAATATAAGAATTAACAACAGAAGAATCA
AAGAATAGCAAGTCTGCTTATTCTAAAATGTTTGACAAAGGATTAATTGAAAGCAACGCT
TTAAAAGTTCTAAAAATTGAATAAAATGAAACAAAATTACTCAACTCGATGTACTCAAAT
AATCTTTTGAATTCAACTGCTCTATATGACTGCTAAAGAAATAGATCATCATATTCTTAG
TAATATATATTTATTCTACCAGTTTTATAAAACCAAATGCATTGTTTTTTAATAAATAAA
TTTTTTAAAAACCACCTGAAAAAAATAGACATGTTGTAGGAAGTGTCTAGAGCAATTTAC
TATAACAGAATAACTCATATATGAATTGCAGTCAGGCACAATTTATTGAAAAAGAAGGTA
TTAAATCAAGTAGACCTTCTCTCAATTAATAGAGTATGACAAGATCAACACATTCTACTT
CCCTTTATGTTGCAAATGAGAGGAAGAGAGTCAAAGAGATATACGAAGATGGTTCTGTCT
ATGAAGGTCAAGTATTAAATGGATTGAGGGATGGGTAAGGCACATTCACTTACTCAAATT
AAGGAGCTAAGTATGTAGGCTAATGGCTTAAAGGTAACATCGAAGGATATGGCATACTTT
TTTTCTCTGACAACAGAGTTGCATACGAAGGCCAATGGAGAGAAAATAAATTCAATGGGA
ACGGAGTCGTATACAATGAAAACCATTCAAAAAGGTAAAGTAAAATAGTTGGTTTCGACT
ATAAAAGTTTTGACAATATTGAAGAAGAATGGTTTAAGTATGATGGAAACTTTGTAGATG
ATCAAAAAGATGGACTTGGAACTCTATACCTAAAAAACGGTGAGAAATTTGTGGGAAACT
TCCACAAAGATGCTGTGAATGGCAATGGAGCATTTTATTTGATTGACGGTACAATAATCT
TAGGAGTTTGGGACAATAATAATTTAGTTCAAGAAACAACAAGAATTAAAAGTTGTTGA


>TTHERM_00277360(protein)
MGIVNSCEKSTRQVDNEVYLNATGGSQCSNRKTLQQTSTLQTQGQNKENQAKQPTNKSNS
YLKQHQENISPIQELTTEESKNSKSAYSKMFDKGLIESNALKVLKIEQNETKLLNSMYSN
NLLNSTALYDCQRNRSSYSQHVVGSVQSNLLQQNNSYMNCSQAQFIEKEGIKSSRPSLNQ
QSMTRSTHSTSLYVANERKRVKEIYEDGSVYEGQVLNGLRDGQGTFTYSNQGAKYVGQWL
KGNIEGYGILFFSDNRVAYEGQWRENKFNGNGVVYNENHSKRQSKIVGFDYKSFDNIEEE
WFKYDGNFVDDQKDGLGTLYLKNGEKFVGNFHKDAVNGNGAFYLIDGTIILGVWDNNNLV
QETTRIKSC