Identifiers and Description

Gene Model Identifier

TTHERM_00279670

Standard Name

RPT1 (26S proteasome regulatory subunit T1)

Aliases

PreTt04810 | 25.m00274 | 3694.m00059

Description

RPT1 26S proteasome regulatory subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00158 ) Sigma-54 interaction domain
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various
  • ( TIGR00382 ) ATP-dependent Clp protease, ATP-binding subunit
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( TIGR02880 ) CbbX protein
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_31456 0
Description: None
WormBase WBGene00004501 9.997093137033517e-262
Description: locus:rpt-1 26S protease regulatory subunit 7 status:Confirmed UniProt:Q18787 protein_id:CAB01414.1
Tetrahymena borealis EI9_08919.1 9.997093137033517e-262
Description: 26S proteasome subunit P45 family protein (432 aa)
DictyBase DDB_G0276917 9.997093137033517e-262
Description: psmC2 on chromosome: 2 position 7234040 to 7235588
Oxytricha Contig11163.0.g1 9.997093137033517e-262
Description: ATPase family associated with various cellular activities (AAA)
SGD YKL145W 9.997093137033517e-262
Description: RPT1 One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00279670(coding)
ATGGCTCCTAGCGCAAACGACAAAGATAATTAACAAGGTGAAGAAAAAAAGCACATCCCT
TTGGATGAAGGTGATATTTCTTTATTGAAAGTTTATGGCATGGGTCCATATGCAGAATCC
ATTAAATCAACTGAAGAAGAAAATAAGAATTTAGTAGTAAAAATTAACAAACTATGCGGT
ATAAAAGAGAGTGATACAGGTCTTTCTTTACCTTCTTAATGGGATTTGAAGGGTGATGAA
ATTAGATTGTCTTAATAACATTCTTTACAAGTCGCTCGTTGCAATAAAATCATTCCTGGT
GACTAACCCACTGAAAATAAATACATGATTAGCATCAAGCAAATGGCCAAATTCGTTGTA
GGTTTAGGTGATAAGCTAGCTCCTACCGATATTGATGAAGGTATGAGAGTTGGTGTTGAG
AAATAAAAATATTCTATTCAACTTCCTCTTCCTCCTAAAATTGATCCTTCAGTCACCATG
ATGACTGTAGAAGAAAAACCTGATGTTACTTATTCAGATATTGGTGGTGCTAATGAATAA
TTAGATCGTCTTAAGGAAGTTGTAGAAATGCCTTTACTCTAGCCTGAAAAGTTTATTGAA
TTGGGTATTGATCCTCCTAAAGGTGTTTTACTCTATGGTCCTCCTGGTACTGGTAAAACC
TTAACTGCAAGAGCCGTTGCCAACAGAACAGATGCCTGCTTCATCCGTGTCATCGGTTCA
GAACTTGTTTAAAGATATGTTGGTGAAGGTGCAAGAATGGTTAGAGAAATCTTCTAGTTA
GCAAGAACCAAGAAAGCTTGTATCATTTTCTTCGATGAAATCGATGCTATTGGTGGTGCT
AGACATGATGACGGTGCTGGTAGTGATAATGAAGTCTAACGTACTATGCTTGAAATCGTA
AATTAATTGGATGGCTTTGAAAGCAGAGGTAACATTAAAGTTTTGATGGCTACAAATAGA
CCTGATACTTTAGATCCCGCTTTGTTAAGACCTGGTAGATTAGATAGAAAGGTTGAATTC
GGTCTTCCAGACTTAGAAGGCAGAACTCACATTTTTAAAATTCATGCCAGACACATGAGT
ATGGAAAAAAATATTCGTTATGAATTATTAGCAAGATTATGCCCTAACACCACTGGTGCT
GATCTTAGATCTGTCTGCACTGAAGCTGGTATGTTCGCCATTAGAGCAAGAAGAAAAGCC
ATCTCTGAAAAGGACCTTCTAGAAGCTATTGAAAAGGTTATAAAAGGATATTCTAAATTC
TCTGCAACTGGCAAATATTTAGTTTATAATTGA


>TTHERM_00279670(gene)
ATGGCTCCTAGCGCAAACGACAAAGATAATTAACAAGGTGAAGAAAAAAAGCACATCCCT
TTGGATGAAGGTGATATTTCTTTATTGAAAGTTTATGGCATGGGTCCATATGCAGAATCC
ATTAAATCAACTGAAGAAGAAAATAAGAATTTAGTAGTAAAAATTAACAAACTATGCGGT
ATAAAAGAGAGTGATACAGGTCTTTCTTTACCTTCTTAATGGGATTTGAAGGGTGATGAA
ATTAGATTGTCTTAATAACATTCTTTACAAGTCGCTCGTTGCAATAAAATCATTCCTGGT
GACTAACCCACTGAAAATAAATACATGATTAGCATCAAGCAAATGGCCAAATTCGTTGTA
GGTTTAGGTGATAAGCTAGCTCCTACCGATATTGATGAAGGTATGAGAGTTGGTGTTGAG
AAATAAAAATATTCTATTCAACTTCCTCTTCCTCCTAAAATTGATCCTTCAGTCACCATG
ATGACTGTAGAAGAAAAACCTGATGTTACTTATTCAGATATTGGTGGTGCTAATGAATAA
TTAGATCGTCTTAAGGTAATTAATTCATTTTAAAAAATAATATAAATCAAAGGAGATGCA
TGCATAAATTTGATATTTCAAAGCAGTAACGAAGTTAGAATGAATAGCGGTATTTTCCTA
TCTAAAATAATAAAGAAATTAAGAAAAAGCATAATCATTTCAGAAAAATATGCATTTATT
TTGAAGATTTTAATAAAAACACTTAGTTTAAATATTTAAACTAAAAAATATGGTTTTTGC
TTTGAAGCATTTATTTATTAACAATAAATAAAAAAGCAAATTAAAATAAGATTTTTATTT
ATTGCATTTTTTATTAATTGAATTGATATTTAACCAATTTATTCCCTTGAATAATAAATA
GGAAGTTGTAGAAATGCCTTTACTCTAGCCTGAAAAGTTTATTGAATTGGGTATTGATCC
TCCTAAAGGTGTTTTACTCTATGGTCCTCCTGGTACTGGTAAAACCTTAACTGCAAGAGC
CGTTGCCAACAGAACAGATGCCTGCTTCATCCGTGTCATCGGTTCAGAACTTGTTTAAAG
ATATGTTGGTGAAGGTGCAAGAATGGTTAGAGAAATCTTCTAGTTAGCAAGAACCAAGAA
AGCTTGTATCATTTTCTTCGATGAAATCGATGCTATGTAATTAAATTAAATATAAACACT
TTCTAAGCATTCAAGCCAAATTTTCAAAATTTATAAATAAACTTTTGATTAACTCATTAT
AATATTTTTTTAAATAATTAATTAATTAATTAATTTAGTGGTGGTGCTAGACATGATGAC
GGTGCTGGTAGTGATAATGAAGTCTAACGTACTATGCTTGAAATCGTAAATTAATTGGAT
GGCTTTGAAAGCAGAGGTAACATTAAAGTTTTGATGGCTACAAATAGACCTGATACTTTA
GATCCCGCTTTGTTAAGACCTGGTAGATTAGATAGAAAGGTTGAATTCGGTCTTCCAGAC
TTAGAAGGCAGAACTCACATTTTTAAAATTCATGCCAGACACATGAGTATGGAAAAAAAT
ATTCGTTATGAATTATTAGCAAGATTATGCCCTAACACCACTGGTGCTGATCTTAGATCT
GTCTGCACTGAAGCTGGTATGTTCGCCATTAGAGCAAGAAGAAAAGCCATCTCTGAAAAG
GACCTTCTAGAAGCTATTGAAAAGGTTATAAAAGGATATTCTAAATTCTCTGCAACTGGC
AAATATTTAGTTTATAATTGA


>TTHERM_00279670(protein)
MAPSANDKDNQQGEEKKHIPLDEGDISLLKVYGMGPYAESIKSTEEENKNLVVKINKLCG
IKESDTGLSLPSQWDLKGDEIRLSQQHSLQVARCNKIIPGDQPTENKYMISIKQMAKFVV
GLGDKLAPTDIDEGMRVGVEKQKYSIQLPLPPKIDPSVTMMTVEEKPDVTYSDIGGANEQ
LDRLKEVVEMPLLQPEKFIELGIDPPKGVLLYGPPGTGKTLTARAVANRTDACFIRVIGS
ELVQRYVGEGARMVREIFQLARTKKACIIFFDEIDAIGGARHDDGAGSDNEVQRTMLEIV
NQLDGFESRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTHIFKIHARHMS
MEKNIRYELLARLCPNTTGADLRSVCTEAGMFAIRARRKAISEKDLLEAIEKVIKGYSKF
SATGKYLVYN