Identifiers and Description

Gene Model Identifier

TTHERM_00279750

Standard Name

GTP1 (GTPase 1 )

Aliases

TGP1 | PreTt04816 | 25.m00280 | 3694.m00065 | Rab8A

Description

GTP1 ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPase family protein; Rab VIII family protein; small monomeric GTPase that regulates membrane fusion and fission events; putative intermediate compartment protein; putative involvement in regulated secretion

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08923.1 3.999453553586398e-137
Description: Ras family protein (205 aa)
Oxytricha Contig7494.0.g64 3.0000115468388957e-66
Description: Ras family
WormBase WBGene00004273 1.9997677415930956e-65
Description: locus:rab-10 status:Confirmed UniProt:Q94148 protein_id:CCD70773.1
DictyBase DDB_G0276399 1.9997677415930956e-65
Description: rab8B on chromosome: 2 position 6878753 to 6879364
SGD YFL005W 2.0007467515522948e-59
Description: SEC4 Rab family GTPase essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane
Stentor Coeruleus SteCoe_21527 1.9792598779469045e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00279750(coding)
ATGTAAAATAAACAAGATTACGATACTTTACTTAAGTTTTTGCTTATTGGTGATTCAGGT
GTTGGAAAAACCTGTTTCCTAGTCAACTATTGCGAAGGTACTTTTACTAGCGCTCACTTA
TCAACAATTGGCATTGATTACAAACTTAAATATGAAGATATTGATGGAAAGCGCGTTAAG
CTCTAAATTTGGGATACTGCAGGCCAAGAAAGATTCAGAACAATTACTTAAAATTATTAC
AAAGGTGCTATGGGTATTATTCTAGCTTATAGTGTAACAGACCCCAATTCTTTCAAGAAT
ATTGCAGATTGGATGAAGTAAATTAATGAACGTGCAGATCCAAATGTTAAAAAGATTATT
ATAGCCACAAAAATTGATATGAAGGATTAAAGAAAAGTCTCTACTCGTGAAGGAGAAGAA
CTTGCTGATAGATATGGTGTAAAATTCTTTGAAACTTCAGCTAAGGAAGGCGTTAATATT
TCCGAAGCTTTCAAGTGTATTGCCCGTTAAACATTAGAATCAATGGACACATCTACTAAA
GATTAGTTTAAAATTAATTACAAACCTAATAATCCTCAACCTAATAAAAAAGATGGAAAA
GATGGAAAATGTTGTTGA


>TTHERM_00279750(gene)
ATGTAAAATAAACAAGATTACGATACTTTACTTAAGTTTTTGCTTATTGGTGATTCAGGT
GTTGGAAAAACCTGTTTCCTAGTCAACTATTGCGAAGGTACTTTTACTAGCGCTCACTTA
TCAACAATTGGCATTGATTACAAACTTAAATATGAAGATATTGATGGAAAGCGCGTTAAG
CTCTAAATTTGGGATACTGCAGGCCAAGAAAGATTCAGAACAATTACTTAAAATTATTAC
AAAGGTGCTATGGGTATTATTCTAGCTTATAGTGTAACAGACCCCAATTCTTTCAAGAAT
ATTGCAGATTGGATGAAGTAAATTAATGAACGTGCAGATCCAAATGTTAAAAAGATTATT
ATAGCCACAAAAATTGATATGAAGGATTAAAGAAAAGTCTCTACTCGTGAAGGAGAAGAA
CTTGCTGATAGATATGGTGTAAAATTCTTTGAAACTTCAGCTAAGGAAGGCGTTAATATT
TCCGAAGCTTTCAAGTGTATTGCCCGTTAAACATTAGAATCAATGGACACATCTACTAAA
GATTAGTTTAAAATTAATTACAAACCTAATAATCCTCAACCTAATAAAAAAGATGGAAAA
GATGGAAAATGTTGTTGA


>TTHERM_00279750(protein)
MQNKQDYDTLLKFLLIGDSGVGKTCFLVNYCEGTFTSAHLSTIGIDYKLKYEDIDGKRVK
LQIWDTAGQERFRTITQNYYKGAMGIILAYSVTDPNSFKNIADWMKQINERADPNVKKII
IATKIDMKDQRKVSTREGEELADRYGVKFFETSAKEGVNISEAFKCIARQTLESMDTSTK
DQFKINYKPNNPQPNKKDGKDGKCC