Identifiers and Description

Gene Model Identifier

TTHERM_00283550

Standard Name

ERF2 (Eukaryotic Release Factor 2)

Aliases

PreTt04894 | 25.m00358 | 3694.m00141

Description

ERF2 eukaryotic peptide chain release factor subunit 1; eRF1 domain 1 family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09000.1 9.997093137033517e-262
Description: eRF1 domain 1 family protein (488 aa)
SGD YBR143C 3.0005221502158484e-68
Description: SUP45 Polypeptide release factor (eRF1) in translation termination; mutant form acts as a recessive omnipotent suppressor; methylated by Mtq2p-Trm112p in ternary complex eRF1-eRF3-GTP; mutation of methylation site confers resistance to zymocin
Oxytricha Contig21968.0.g12 9.000460706442912e-62
Description: eRF1 domain 2
WormBase WBGene00020269 4.998338612125368e-60
Description: locus:erfa-1 status:Confirmed UniProt:S6EZT6 protein_id:CDG24149.1
DictyBase DDB_G0288613 2.000065869309806e-55
Description: erf1 on chromosome: 5 position 1753244 to 1754781
Stentor Coeruleus SteCoe_8516 7.984904245686979e-30
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00283550(coding)
ATGGAGTAGAAGCCACCGTTTTAAAATCCGCTTTAGAAACTGTAAGATCGAGGGACTAAA
ATGGATTAAAGCAGCGGCTCCTGCATGAGCAAATAAGCTGAGGAGTAGAAGCGATTGTAA
ATTTCTTAATACTAATTAAGAAAACAATTGTAAATGCTCCGAAACATGCGAGGAGAGTAA
ACAAGCTGTGTTTCATTATATATTCCTGAGAGAAAGAAATTATATGAAGTTGTCAATTAT
TTACAGTAAGAAGAAAGTGGTGCAGCCTCTATTAAAAATACCCAAAATCGTAAATCTGTG
CAGAGTGCTTTATCAATGCTCCGTGAACGTTTGAAGAATTTCAACCTTCACAAAAAGTAT
CCTAAAGGTATGATTTTCTTTTGTGCTGATTCTCTAGATTCTAAGCGTCTTTTGATCGAA
ATTCTAGATCCTCCAAAGGCAGTTCAGTCTTTCCGCTATTCTTGCAATACCATATTTTAT
CTAGATGACCTTGAATATATGCTTAAGGACTAACCAACATATGGTTTTGTTGTCGCAGAC
GGACATGGATATCTGATAGCTACAGTCTGCGGCTTTGATATTTAAATCCTCTAAAGTAAA
TAAGAGGATCTTCCTAATAAACATAACAAAGGTGGTTAGTCGTCTTTAAGATTTTCTAGG
CTTTGCGATGCTGCGAGAGAAAGATTAGTTAAGAATATAGCTGACGCTATGAGAAGATGC
TATGCTAATGAGAATGGAACATAAACTAATCTTAGTGGAATAGTGCTTTGTGGAATGAGT
GATATCAAAGATAAAGTGCAAAAAGAGCTTTAGCAGTTATGTCCTTGCATAGAGAACAAA
ATAGTTGCTAGCTATGATGTAAGTTATAGTGGTTAAGCAGGACTAAAGTAGGCTCTTTAA
ATGAGTACCGAGATGTTAAAGTTAGACTAACTCTTTTAAGAGATGAATCTCCTCAGTGAC
TTTTTCGCTAATTTCAGTCTTGAAACAAGCAAAGTTGTTTATGGAGGAGAGCTAACTGTT
CGAGCTTTAGAAGAAGGAAATGTTAAAAAGCTAATTCTCTGCTAGGATTCAGAACTTCAA
AGAGTTACAGTTTATAACTCTAAAACTCAAGAAGAAACTATCTAATACTTAATGCCATCA
CAAGTGAAAGCACTCTAAGACTCTATTTCAAAGACTAGTGACTAAGAAGCCAACAATAAG
AAAAACTAATTACAAGTATACTCACAATAAAACATCAACGAATGGATTGTTGAAAATATT
TCTTCATTTAGTTAAGATTTAGAAATTGTTTTTGTAAGTGATAAGACTTAGTAAGGCGTT
TAGTTTTCTAAAAGCTTTTAAGGAGTTGGTGCTTATCTCAAATACTCTCTTGATTACTCA
TCACTTCATGCTCAAGAAAAAGAGAATGACCAACTTGAACAAGAATATTGCTATGATGAC
GAGGAAGGTTTTATTTGA


>TTHERM_00283550(gene)
ATGGAGTAGAAGCCACCGTTTTAAAATCCGCTTTAGAAACTGTAAGATCGAGGGACTAAA
ATGGATTAAAGCAGCGGCTCCTGCATGAGCAAATAAGCTGAGGAGTAGAAGCGATTGTAA
ATTTCTTAATACTAATTAAGAAAACAATTGTAAATGCTCCGAAACATGCGAGGAGAGTAA
ACAAGCTGTGTTTCATTATATATTCCTGAGAGAAAGAAATTATATGAAGTTGTCAATTAT
TTACAGTAAGAAGAAAGTGGTGCAGCCTCTATTAAAAATACCCAAAATCGTAAATCTGTG
CAGAGTGCTTTATCAATGCTCCGTGAACGTTTGAAGAATTTCAACCTTCACAAAAAGTAT
CCTAAAGGTATGATTTTCTTTTGTGCTGATTCTCTAGATTCTAAGCGTCTTTTGATCGAA
ATTCTAGATCCTCCAAAGGCAGTTCAGTCTTTCCGCTATTCTTGCAATACCATATTTTAT
CTAGATGACCTTGAATATATGCTTAAGGACTAACCAACATATGGTTTTGTTGTCGCAGAC
GGACATGGATATCTGATAGCTACAGTCTGCGGCTTTGATATTTAAATCCTCTAAAGTAAA
TAAGAGGATCTTCCTAATAAACATAACAAAGGTGGTTAGTCGTCTTTAAGATTTTCTAGG
CTTTGCGATGCTGCGAGAGAAAGATTAGTTAAGAATATAGCTGACGCTATGAGAAGATGC
TATGCTAATGAGAATGGAACATAAACTAATCTTAGTGGAATAGTGCTTTGTGGAATGAGT
GATATCAAAGATAAAGTGCAAAAAGAGCTTTAGCAGTTATGTCCTTGCATAGAGAACAAA
ATAGTTGCTAGCTATGATGTAAGTTATAGTGGTTAAGCAGGACTAAAGTAGGCTCTTTAA
ATGAGTACCGAGATGTTAAAGTTAGACTAACTCTTTTAAGAGATGAATCTCCTCAGTGAC
TTTTTCGCTAATTTCAGTCTTGAAACAAGCAAAGTTGTTTATGGAGGAGAGCTAACTGTT
CGAGCTTTAGAAGAAGGAAATGTTAAAAAGCTAATTCTCTGCTAGGATTCAGAACTTCAA
AGAGTTACAGTTTATAACTCTAAAACTCAAGAAGAAACTATCTAATACTTAATGCCATCA
CAAGTGAAAGCACTCTAAGACTCTATTTCAAAGACTAGTGACTAAGAAGCCAACAATAAG
AAAAACTAATTACAAGTATACTCACAATAAAACATCAACGAATGGATTGTTGAAAATATT
TCTTCATTTAGTTAAGATTTAGAAATTGTTTTTGTAAGTGATAAGACTTAGTAAGGCGTT
TAGTTTTCTAAAAGCTTTTAAGGAGTTGGTGCTTATCTCAAATACTCTCTTGATTACTCA
TCACTTCATGCTCAAGAAAAAGAGAATGACCAACTTGAACAAGAATATTGCTATGATGAC
GAGGAAGGTTTTATTTGA


>TTHERM_00283550(protein)
MEQKPPFQNPLQKLQDRGTKMDQSSGSCMSKQAEEQKRLQISQYQLRKQLQMLRNMRGEQ
TSCVSLYIPERKKLYEVVNYLQQEESGAASIKNTQNRKSVQSALSMLRERLKNFNLHKKY
PKGMIFFCADSLDSKRLLIEILDPPKAVQSFRYSCNTIFYLDDLEYMLKDQPTYGFVVAD
GHGYLIATVCGFDIQILQSKQEDLPNKHNKGGQSSLRFSRLCDAARERLVKNIADAMRRC
YANENGTQTNLSGIVLCGMSDIKDKVQKELQQLCPCIENKIVASYDVSYSGQAGLKQALQ
MSTEMLKLDQLFQEMNLLSDFFANFSLETSKVVYGGELTVRALEEGNVKKLILCQDSELQ
RVTVYNSKTQEETIQYLMPSQVKALQDSISKTSDQEANNKKNQLQVYSQQNINEWIVENI
SSFSQDLEIVFVSDKTQQGVQFSKSFQGVGAYLKYSLDYSSLHAQEKENDQLEQEYCYDD
EEGFI