Identifiers and Description

Gene Model Identifier

TTHERM_00285680

Standard Name

RRM7 (RNA recognition motif-containing protein 7)

Aliases

PreTt25897 | 26.m00249 | 3688.m00045

Description

RRM7 RNA recognition motif protein putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09285.1 9.997093137033517e-262
Description: hypothetical protein (1120 aa)
Oxytricha Contig22254.0.g55 1.0002124404074584e-26
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
SGD YER068W 9.000561397357242e-21
Description: MOT2 Subunit of the CCR4-NOT complex, which has roles in transcription regulation, mRNA degradation, and post-transcriptional modifications; with Ubc4p, ubiquitinates nascent polypeptide-associated complex subunits and histone demethyase Jhd2p
WormBase WBGene00003827 3.0002687256732656e-20
Description: locus:ntl-4 status:Partially_confirmed protein_id:CDM63498.1
Stentor Coeruleus SteCoe_32514 0.000000002061153622438558
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00285680(coding)
ATGAGTAGCGATAAAAACAAAGGCGGATTCAAAGTAGTCAATGGTCCTAAATCAAATTAA
GGAGCCCTTATCTCAACCCTCTCTATAAATTAAGCAAATTCAAATTAAAATTTACAGGAA
TAAAGAATCATACAAACAAATTTAGTATTTTTGAATGGACTCGATGCAAAGCTTTGTAAA
GAAGAGGTTTTAAAGAAGAAGCAGTATATGGGATAGTATGGAAATGTTAAAAAAGTTATT
TTAAAGCAGGAGGGTAATAGAGATTAAAATTCAGTTGGTGTTTATGTTTCATATTCTTCT
CCTAATGAGGCTTCAATTGCGATATTAGCATTAGATTAATTTGAACTCGATAGCAAGCCA
TTAAGAGCATTTTATGGATCAACTAAATACTGTAATTCATTTTTAAATGGCTAATAATGT
ATTAAAAAAGATTGTCCTTATTTGCATGAAAAAGCAAAAGAGCATACATTTTATAAAGAT
TAAAGATTTTATATAAATTATAAAGAAATAGCATTAAAAATAGTGAATTAAAAAATTAGT
TTTTACAATAATTATTCATCAGTTTAAAACCCTATATTTCCAGATGTTATGATAGTATTA
AATGAATTAAAATCTTAATTATAAATACCTGATACACTCACTACTGCAGTATTAAAAGCG
AACGATTCTAAGAACTCTGCAGTTATTATTAATAATATTACAGCATGTACTTGGGATGAT
GATGATGCTATGACAAATGAGGGAATTTAAAATTAAAATTAAGATTAAAATTAAAATTTT
GAGATTTAAAACTAAGAATATATTTAAAATTAAGACATTAACATCACTCAGAAAGATATA
AACTTATTTAATTAAAATACAAACTAGTTACAGCACCCTTTATTTGATTTAAAATCTATG
AATACTTTAAATTATTATAAGATGGTCGAAAAATTAGATTTGCCTTTTTAAAATCCTAAT
TTGTATTAGTTATTATAACAACCTGATATACAATAATAGCTTGGTATAAATTAATACATT
AACAGGGTAGAGCTTGATTCTATAAATTACTCACCAAATTAATTCTATTTTGATGATAAA
TTTTAACTAGCAGAAAATTCTTAAACTAGTAGATTTTTTAATGACTCTAGCAAGAGCTTT
AAATTTAAAAATATATGGGGACCTGTTGGTTAAAAAAAAAGCTCACTTAAAATTGAAAAT
CCTAATAATCCTAATTATATAAATGGTTTGTAAGGAAATGATTGCATATAATTACCTCAA
AGTAATGAAGAAGATGAATTTAGTGTGCTTAACACATTTATTTTGGCATATAACATTACT
CATAGTTTGTGGATTCCTTATGTCAAATTGCAAAATTTAACTGAAAAGATATTTAAAAAA
CTACTGGTTGATCAATAAATATCTTAATTTAGTTTCAATAAATACATGTTTGATAATGAT
AACTGGATGTTGGAATTCCTTGAAAATAACTTATTTACTGATGAAGAAAAAGAAATTATT
TTGAGTGCTGCTAGAAGTACATTTAAGGATAAAAATCTACTATATGTTGATATTGCTCCA
TAATGTGTTGACTTGTTTACTCCTGTAGTTGAACAGAAGCAGCAATTGCAAGAGGTTTAA
ACAATATTTACTTTACATCCGAATCATTAAAAGCAAAGAAAAAGATCTTCGAATTCTCTT
TAGAGCACTAATCACAGCAGTATGGGTGGAGAGCTAGCAGATCTTGAGGAGAGTAAACAC
AATGAAGAAAACAGCTAACTGATAAAAAGCAATATTTTTCCTTAATCTTCAAATTAAAGT
AAAACAAGCAAAACAAAATTAAATAATAATGCATAATCAAGTTCTTCTGATGCACCTAAA
AAAGCTGAAGAAAAATAGCAAAGTGTTTAAAATATAAATAAACCAATAAAGAGTAGTTCC
ATAACTAGTCAACCTAGTAATTTATCTTCTTCAATTGTTAAGAATGAGTTTCAAATCTAA
AAATAATCTAGTAACTAAAACTCATAAAAGTTAGAGCTTAATAAAAGCGCTTCTTAATAG
TCTTCAAAAAATATAAATTCAACTGTCAACTAGCAAGTAAAAACAATTTAAAAAACAACT
TAAAATCCTGCAAGCAATACTGCTAATACTAATAAAGTAAATGGAACTAAAGTTGTCTCT
AGTTCCACTTCATAGCAAGAAACTTAAATAAAAAAGCAGGAATCAGAAAAAGAAAAGAAT
GAACAAGATGAAGAATTTGTGAGCATTTAGCCAAAAGGAGGAGCTATAAAATTGGAATTA
GCTGACAAAAAGAAGGAGAGAGTTGATAACAACATGTTCACATTTTTAGAAAATGAATAA
GAAGAAGATGAAGATAAAGATAAAGATAAAGAGGAACAATAAAAGCAAAAGAATGATAAT
ACAACTAAAAAGCAAAAAACCAAAGTAAAATAAGCTGAAAAACCTGAGAAAAAGACCTCA
AAAAAAATGAACTCTAAATAGCTAGAGCAATAATAATTGAAGGAAGAGAAGAAAAAGAGG
TAGGAGGAATATCAGCTTTTAAATGAACAACTTAATCTGATCAAATAAGAGAAAGAAAAA
AACAAGTAAAAACAGCAGGAGTAAAAGCAAGAATAGATGCAATAACAGCAAAAAAAAAAG
TAAAAAGAGTAAGAGAAGGAATAGTAACAATAGGCATAAGCTGATAAATCTTAAATTTTG
AATCCTTTGATAAATGGAGGTTGCTTGAAGTTTAATTGTAATTCAATAAATTGCCACGAA
ATAAGCGGCTAACAGATTTTAGTGCAAAATGGTGAAATTCAAATTCCTTAAATTAAGCAG
AGCACTTTTGATAAAAAGAGAAAGAAAAGACAAGAAAGCAGTCTTAATAGCATTGACATA
TAGAAATAAATTAGCAACTTAATGAGCATAGACCCAAAGGCATTTTAATTTCAAAATTAG
AATAGATTAGTTAACTAGTAATTAGCATTCCATGCTGAAGCTAGCGTTACTAATATAAAT
GTGACTAAAGAAGGCATAAATATAAGTGCTAATATTACTAAATCAACTCAGTAAGGACTC
TTACCACCAGAAATTACAAAAAATGCTTCTAAAATTTAAATGCCAAACAACATAGTAGTT
CGTTTTGATAATGTAGATAATACAAACAAAACTTCTACAATACAAAATACTATATCTACC
AATGTTCCTATTGATAGTAAACTGAACTATAGATCTAGCAAATCTAAAAATGAGAAAAAT
CTTGCAAATAAGAAGAAAGAAGAGAAGCAAGTTTAGTATGAAAGCAAAGGTGAGTAGGCT
GTGTACAAAGGCACTCCAGAGGTAGGAATTAATGATGATAATGAGTGA


>TTHERM_00285680(gene)
ATGAGTAGCGATAAAAACAAAGGCGGATTCAAAGTAGTCAATGGTCCTAAATCAAATTAA
GGAGCCCTTATCTCAACCCTCTCTATAAATTAAGCAAATTCAAATTAAAGTAGATTTATT
TTAGATTTTCGCTTATTAGAAATATTTTTTTTTGTGTATGCGTTATTATGATATTTACAA
ATATCTCATTTAGATAATTCATTAATGTAGTTTTTTCATAAATTCAACAGATTTACAGGA
ATAAAGAATCATACAAACAAATTTAGTATTTTTGAATGGACTCGATGCAAAGCTTTGTAA
AGAAGAGGTAACAAGATGCACAAACATTATAAGAAGATTTTAGTTTTAAAAAAGCCTACA
ATTTAAAAAAAAACAAGCAAAAAAAGGCTTGTTTATAAGCTATGATAATTTAATACTTTT
ATCTTTAAGTTTCTTAAGTACTTTCAAAAAGAAGCTGGCTTGCTTCAATGTTAAAACTAA
AAAAGCAAAAGCAAAATAAAATATTTTTTTGACATTATTTATCATAAAATTAGGTTTTAA
AGAAGAAGCAGTATATGGGATAGTATGGAAATGTTAAAAAAGTTATTTTAAAGCAGGAGG
GTAATAGAGATTAAAATTCAGTTGGTGTTTATGTTTCATATTCTTCTCCTAATGAGGCTT
CAATTGCGATATTAGTAATAGAATAATAACTACTTTCTATTTGATTATTTTCTATTAAAT
GCTTTTATTTTATTCCCGCGCTCAAAGTGCTTCAACTCAATTTTTATTTATTAATAGGCA
TTAGATTAATTTGAACTCGATAGCAAGCCATTAAGAGCATTTTATGGATCAACTAAGTAG
GCATTAAAATATATTTCTTCTTTTTCTCTTCTTCTCTCTTTTATATATATATCTCTAACT
TTTTACCAGCAAACCAAAAGAATATTACGCCAAGTGCTCTTATAATTAACTCATAAAAAT
AATAAGCTAAAGGGATCATGATCATAAATCTTTTTTTAGCTATTTTGAGCCATTTATTCA
CTTTATTATAGTTTTTGAATATCACTTCTAGCATTTAAATTGCAATTTTTAGAGACTAAC
AACAAACACTTGTTGAATTAATATGCCACTAAAAAGTTAAAGAAATATGTTTTTACTTAA
ACATATTTAGGGATTTATGAAGCATTTAGGTTAGTTGGTTTGATTTGGAGATATATAGAC
AAAGAGAAAGATAGATAATAAATAAAACAGTTATTTAAAATAATACTTAATATTTTCATA
ATATAAATAAAATAGATACTGTAATTCATTTTTAAATGGCTAATAATGTATTAAAAAAGA
TTGTCCTTATTTGCATGAAAAAGCAAAAGAGCATACATTTTATAAAGTAAGTTTAGTCTT
TATTGATTAGCTTGGAAATATTAATTAACAACATATCTATCTATCAGTCTGGCTTAATCT
TGATCTTTTTTATTAAAAAAAAAATGAATTTTTACATTTTTAAAATTATTGGTTGGAAAT
CAATCTGAATTTAATAAATTATTTATTTCCTTAAAAATTCCTTTACATTTAAAGAATATT
CTATAGGATAAAACAAATTGGTTATCAGCAAATAAAAATATTGTATTCAATATGGCAAAC
TATATACTTAACTAATGTTTAAAGAGATATCAAATATTTAAAAGTTAATAGCATCTTAAA
TAAAAGGAAATAATTTAGACATTAAAATACATCAAGTTAAATAAAATATTTAGGAAAAAA
TCTTTTTTAAAATTGTATAAGAAATAATTTTTATTGAATTAGGAGCTATGTAAAAAAAAG
AAAATAAATATTGATTATTTAATATCAAAAAGTGAGTAAGGAAGGAAGTAAGGATATTTT
GTAAATTAAGAGATAAGATGAGACTGATTGATTGATAAATAAATAAATAAATAAAATTTT
ATAATGAAAAAAATATTTACTTATAAATTAATTTTATTTTAATAAAAATAATAAATTAAT
AGGATTAAAGATTTTATATAAATTATAAAGAAATAGCATTAAAAATAGTGAATTAAAAAA
TTAGTTTTTACAATAATTATTCATCAGTTTAAAACCCTATATTTCCAGATGTTATGATAG
TATTAAATGAATTAAAATCTTAATTATAAATACCTGATACACTCACTACTGCAGTATTAA
AAGCGAACGATTCTAAGAACTCTGCAGTTATTATTAATAATATTACAGCATGTAATTAAT
CATTTTGCATCTTATTTTCAACTAACAATCGTTGTTGTAATTTTAAAAAGGTACTTGGGA
TGATGATGATGCTATGACAAATGAGGGAATTTAAAATTAAAATTAAGATTAAAATTAAAA
TTTTGAGATTTAAAACTAAGAATATATTTAAAATTAAGACATTAACATCACTCAGAAAGA
TATAAACTTATTTAATTAAAATACAAACTAGTTACAGCACCCTTTATTTGATTTAAAATC
TATGAATACTTTAAATTATTATAAGATGGTCGAAAAATTAGATTTGCCTTTTTAAAATCC
TAATTTGTATTAGTTATTATAACAACCTGATATACAATAATAGCTTGGTATAAATTAATA
CATTAACAGGGTAGAGCTTGATTCTATAAATTACTCACCAAATTAATTCTATTTTGATGA
TAAATTTTAACTAGCAGAAAATTCTTAAACTAGTAGATTTTTTAATGACTCTAGCAAGAG
CTTTAAATTTAAAAATATATGGGGACCTGTTGGTTAAAAAAAAAGCTCACTTAAAATTGA
AAATCCTAATAATCCTAATTATATAAATGGTTTGTAAGGAAATGATTGCATATAATTACC
TCAAAGTAATGAAGAAGATGAATTTAGTGTGCTTAACACATTTATTTTGGCATATAACAT
TACTCATAGTTTGTGGATTCCTTATGTCAAATTGCAAAATTTAACTGAAAAGATATTTAA
AAAACTACTGGTTGATCAATAAATATCTTAATTTAGTTTCAATAAATACATGTTTGATAA
TGATAACTGGATGTTGGAATTCCTTGAAAATAACTTATTTACTGATGAAGAAAAAGAAAT
TATTTTGAGTGCTGCTAGAAGTACATTTAAGGATAAAAATCTACTATATGTTGATATTGC
TCCATAATGTGTTGACTTGTTTACTCCTGTAGTTGAACAGAAGCAGCAATTGCAAGAGGT
TTAAACAATATTTACTTTACATCCGAATCATTAAAAGCAAAGAAAAAGATCTTCGAATTC
TCTTTAGGTATAATAATTCGATTTAAAAAATAGCTAAAATTTAAATAATTTTATACAGAG
CACTAATCACAGCAGTATGGGTGGAGAGCTAGCAGATCTTGAGGAGAGTAAACACAATGA
AGAAAACAGCTAACTGATAAAAAGCAATATTTTTCCTTAATCTTCAAATTAAAGTAAAAC
AAGCAAAACAAAATTAAATAATAATGCATAATCAAGTTCTTCTGATGCACCTAAAAAAGC
TGAAGAAAAATAGCAAAGTGTTTAAAATATAAATAAACCAATAAAGAGTAGTTCCATAAC
TAGTCAACCTAGTAATTTATCTTCTTCAATTGTTAAGAATGAGTTTCAAATCTAAAAATA
ATCTAGTAACTAAAACTCATAAAAGTTAGAGCTTAATAAAAGCGCTTCTTAATAGTCTTC
AAAAAATATAAATTCAACTGTCAACTAGCAAGTAAAAACAATTTAAAAAACAACTTAAAA
TCCTGCAAGCAATACTGCTAATACTAATAAAGTAAATGGAACTAAAGTTGTCTCTAGTTC
CACTTCATAGCAAGAAACTTAAATAAAAAAGCAGGAATCAGAAAAAGAAAAGAATGAACA
AGATGAAGAATTTGTGAGCATTTAGCCAAGTAAAATTATTTTTATTTAAACACAGATTTA
TTTGATGAATTTGTCTATATTTTTATATTGATAATTAATTAAATAATTTATTTACTAAAT
GATTAGAAGGAGGAGCTATAAAATTGGAATTAGCTGACAAAAAGAAGGAGAGAGTTGATA
ACAACATGTTCACATTTTTAGAAAATGAATAAGAAGAAGATGAAGATAAAGATAAAGATA
AAGAGGAACAATAAAAGCAAAAGAATGATAATACAACTAAAAAGCAAAAAACCAAAGTAA
AATAAGCTGAAAAACCTGAGAAAAAGACCTCAAAAAAAATGAACTCTAAATAGCTAGAGC
AATAATAATTGAAGGAAGAGAAGAAAAAGAGGTAGGAGGAATATCAGCTTTTAAATGAAC
AACTTAATCTGATCAAATAAGAGAAAGAAAAAAACAAGTAAAAACAGCAGGAGTAAAAGC
AAGAATAGATGCAATAACAGCAAAAAAAAAAGTAAAAAGAGTAAGAGAAGGAATAGTAAC
AATAGGCATAAGCTGATAAATCTTAAATTTTGAATCCTTTGATAAATGGAGGTTGCTTGA
AGTTTAATTGTAATTCAATAAATTGCCACGAAATAAGCGGCTAACAGATTTTAGTGCAAA
ATGGTGAAATTCAAATTCCTTAAATTAAGCAGAGCACTTTTGATAAAAAGAGAAAGAAAA
GACAAGAAAGCAGTCTTAATAGCATTGACATATAGAAATAAATTAGCAACTTAATGAGCA
TAGACCCAAAGGCATTTTAATTTCAAAATTAGAATAGATTAGTTAACTAGTAATTAGCAT
TCCATGCTGAAGCTAGCGTTACTAATATAAATGTGACTAAAGAAGGCATAAATATAAGTG
CTAATATTACTAAATCAACTCAGTAAGGACTCTTACCACCAGAAATTACAAAAAATGCTT
CTAAAATTTAAATGCCAAACAACATAGTAGTTCGTTTTGATAATGTAGATAATACAAACA
AAACTTCTACAATACAAAATACTATATCTACCAATGTTCCTATTGATAGTAAACTGAACT
ATAGATCTAGCAGTAAAATAAAAATAATTTAATATCCATATTGTAATTTATTAATACTAA
AATTTTAGAATCTAAAAATGAGAAAAATCTTGCAAATAAGAAGAAAGAAGAGAAGCAAGT
TTAGTATGAAAGCAAAGGTATTTAATTTTTTTTAATTGATTTATCATTTTAACTTAAAAT
ATTTTTTATAAAATAGTGTACCACAGTGATTTAATAAGTAAATATAATCTTACTCAATTT
AAAATTTTAGATTAACTTTTTTGAAATTAAATTTATATTATTTAATGAAAAGGTGAGTAG
GCTGTGTACAAAGGCACTCCAGAGGTAGGAATTAATGGTAAAATATATTCAATATTTTTT
AATTTTATTTAATCTTTTTATAATTAAACAGATGATAATGAGTGA


>TTHERM_00285680(protein)
MSSDKNKGGFKVVNGPKSNQGALISTLSINQANSNQNLQEQRIIQTNLVFLNGLDAKLCK
EEVLKKKQYMGQYGNVKKVILKQEGNRDQNSVGVYVSYSSPNEASIAILALDQFELDSKP
LRAFYGSTKYCNSFLNGQQCIKKDCPYLHEKAKEHTFYKDQRFYINYKEIALKIVNQKIS
FYNNYSSVQNPIFPDVMIVLNELKSQLQIPDTLTTAVLKANDSKNSAVIINNITACTWDD
DDAMTNEGIQNQNQDQNQNFEIQNQEYIQNQDINITQKDINLFNQNTNQLQHPLFDLKSM
NTLNYYKMVEKLDLPFQNPNLYQLLQQPDIQQQLGINQYINRVELDSINYSPNQFYFDDK
FQLAENSQTSRFFNDSSKSFKFKNIWGPVGQKKSSLKIENPNNPNYINGLQGNDCIQLPQ
SNEEDEFSVLNTFILAYNITHSLWIPYVKLQNLTEKIFKKLLVDQQISQFSFNKYMFDND
NWMLEFLENNLFTDEEKEIILSAARSTFKDKNLLYVDIAPQCVDLFTPVVEQKQQLQEVQ
TIFTLHPNHQKQRKRSSNSLQSTNHSSMGGELADLEESKHNEENSQLIKSNIFPQSSNQS
KTSKTKLNNNAQSSSSDAPKKAEEKQQSVQNINKPIKSSSITSQPSNLSSSIVKNEFQIQ
KQSSNQNSQKLELNKSASQQSSKNINSTVNQQVKTIQKTTQNPASNTANTNKVNGTKVVS
SSTSQQETQIKKQESEKEKNEQDEEFVSIQPKGGAIKLELADKKKERVDNNMFTFLENEQ
EEDEDKDKDKEEQQKQKNDNTTKKQKTKVKQAEKPEKKTSKKMNSKQLEQQQLKEEKKKR
QEEYQLLNEQLNLIKQEKEKNKQKQQEQKQEQMQQQQKKKQKEQEKEQQQQAQADKSQIL
NPLINGGCLKFNCNSINCHEISGQQILVQNGEIQIPQIKQSTFDKKRKKRQESSLNSIDI
QKQISNLMSIDPKAFQFQNQNRLVNQQLAFHAEASVTNINVTKEGINISANITKSTQQGL
LPPEITKNASKIQMPNNIVVRFDNVDNTNKTSTIQNTISTNVPIDSKLNYRSSKSKNEKN
LANKKKEEKQVQYESKGEQAVYKGTPEVGINDDNE