Identifiers and Description

Gene Model Identifier

TTHERM_00290900

Standard Name

RAB69 (RAB GTPase 69)

Aliases

PreTt26022 | 26.m00374 | 3688.m00166

Description

RAB69 Ras family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09381.1 8.001138423028812e-95
Description: Ras family protein (400 aa)
WormBase WBGene00004269 2.00017271388466e-38
Description: locus:rab-6.1 Ras-related protein Rab-6.1 status:Confirmed UniProt:P34213 protein_id:CAA77590.1
Oxytricha Contig15751.0.0.g87 3.9997566980151843e-38
Description: Ras family
DictyBase DDB_G0271984 1.999002769139511e-37
Description: rab5A on chromosome: 2 position 1113320 to 1114208
SGD YLR262C 3.0001084582952455e-37
Description: YPT6 Rab family GTPase, Ras-like GTP binding protein involved in the secretory pathway, required for fusion of endosome-derived vesicles with the late Golgi, maturation of the vacuolar carboxypeptidase Y; has similarity to the human GTPase, Rab6
Stentor Coeruleus SteCoe_10189 1.5628821893349888e-18
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00290900(coding)
ATGGCATCGAGAAGAGATAATAAAATTCTAGAAAGCAAGGTTATACTTCTTGGAGAATAA
AGAGTAGGTAAATCAAGTATAATTAATAGATTCATAAATGACTAGTTTGATCCAGATTCT
AAACCAACTTCTATCGGAGGAAATCAATAGGCTTATTCAGATAAAATAATTTAAGTTTTC
AATGGAGGCAAAATTAAAATAAATTTATGGGATACAGCTGGGCAAGAGATATTTTCTTCT
ATTGTTTCTGTATACTATAAGTCTGCTTAAGCTGCTATAGTTGTGTTTGATCTTACTGAT
AGAAGCACAATAAATAAGGCACACAAATGGATTTAGGAAGTACAAAATAATAATGAAAAA
AACGATTGCAAAATTATTTTGGTTGGTAATAAATATGATAAAAATAATGAAAGGTAGATT
AAAACTGAAGAAGGATAAGAAATTGCAAAACAATATAAAATTAAGTATTATGAAACTTCT
GCTAAAAATTCTTATAATATAAAGGAGCTCTTCTCAGATTTAGCTGAAGAACTCTACACT
GACAATAAGAATGCTACTAAAAAACCATCTAGAATTACAATTGATAATTTTAAAAAATAA
AAAGATACAAAATCTAAAGAAGATAGCAGCTGTTCATGCTGA


>TTHERM_00290900(gene)
ATGGCATCGAGAAGAGATAATAAAATTCTAGAAAGCAAGGTTATACTTCTTGGAGAATGT
ATGTCATTTTGTTTATTTGCTCTAAAAATAATCAAGCCTTTAAAACTATTTTGTTAAACT
TATTAATAAATTATATTGTATGATAAATAGAAAGAGTAGGTAAATCAAGTATAATTAATA
GATTCATAAATGACTAGTTTGATCCAGATTCTAAACCAACTTCTATCGGAGGAAATCAAT
AGGCTTATTCAGATAAAATAATTTAAGTTTTCAATGGAGGCAAAATTAAAATAAATTTAT
GGGTAAATTATTCTTAATTTATTTTAATTCTTAGTTTTAGGATTAGCTATTTAAAGATTA
TTCATTTACGCACACCACCAATCTAATAAACTATTTAAAGAATAATTGAAAATTAAATTT
AAAAACTGATATAATAAAGGATACAGCTGGGCAAGAGATATTTTCTTCTATTGTTTCTGT
ATACTATAAGTCTGCTTAAGCTGCTATAGTTGTGTTTGATCTTACTGATAGAAGCACAAT
AAATAAGGTAATTATTTTTAAGAATAACAAAATGAGGATAGAAACTAATTACTTTAGCAT
AAATAAATAATCAAGTTTTATTTGCACAACATTCATGCATCTTTTTAAAAGAATAAAGAA
TTTATGTATTATTTATTAAATTAATTAGGCACACAAATGGATTTAGGAAGTACAAAATAA
TAATGAAAAAAACGATTGCAAAATTATTTTGGTTGGTAATAAATATGATAAAAATAATGA
AAGGTAGATTAAAACTGAAGAAGGATAAGAAATTGCAAAACAATATAAAATTAAGTATTA
TGAAACTTCTGCTAAAAATTCTTATAATATAAAGGAGCTCTTCTCAGATTTAGCTGAAGG
TATTCTTAAATATTTCTTTTTCTATACTTACAGAAATTTTTACTTGATTAGGAATTAAAA
TTAATAATATTATTAAAATACTTAATTAAAAAAACTAACTAAAAACAGACAGACAGATGA
TAATAAATAGTATCATCTTAACTAATATTTATTTTTTATCCAAATTATTTGATAAGAAAA
TCAACTCTCTAAGATAAAAAATTGGTAATTTACTAAAAAAACAGATTCAAAAATAGTAAA
AAACAAATTATTTTTTAGCATACAAAGAAAAAAGCAAGTATTATTTGTTTAAAAAAGAAA
AAAACAAGTTTAAATAAAAATGCAAGTAAGTTAGTAATTTAATTGTAAATAATATTTTTT
ATAGTCTTGAGGAAAGTTAAAAAGATTAAAAATTAAATATTTTAAAGTAGATTGATAACT
AAGAGAGAATGATTTATGATAAATAAGATTGAAGATATATTTTGCTTTATTAAAAAAAAT
AAATTTAATTTTAAGTTAATTTACATTTTAAAAAATAGAACTCTACACTGACAATAAGAA
TGCTACTAAAAAACCATCTAGAATTACAATTGATAATTTTAAAAAATAAAAAGATACAAA
ATCTAAAGAAGATAGCAGCTGTTCATGCTGA


>TTHERM_00290900(protein)
MASRRDNKILESKVILLGEQRVGKSSIINRFINDQFDPDSKPTSIGGNQQAYSDKIIQVF
NGGKIKINLWDTAGQEIFSSIVSVYYKSAQAAIVVFDLTDRSTINKAHKWIQEVQNNNEK
NDCKIILVGNKYDKNNERQIKTEEGQEIAKQYKIKYYETSAKNSYNIKELFSDLAEELYT
DNKNATKKPSRITIDNFKKQKDTKSKEDSSCSC