Identifiers and Description

Gene Model Identifier

TTHERM_00292140

Standard Name

SEC141 (SECretory pathway (SEC14 homolog))

Aliases

PreTt26047 | 26.m00399 | 3688.m00190

Description

SEC141 CRAL/TRIO amine-terminal domain protein; Putative phosphatidylinositol/phosphatidylcholine transfer protein; CRAL/TRIO- N-terminus family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09402.1 9.997093137033517e-262
Description: CRAL/TRIO, family protein (363 aa)
Oxytricha Contig20661.0.g89 5.001580789778561e-97
Description: CRAL/TRIO domain
SGD YMR079W 1.999576471039937e-58
Description: SEC14 Phosphatidylinositol/phosphatidylcholine transfer protein; involved in regulating PtdIns, PtdCho, and ceramide metabolism, products of which regulate intracellular transport and UPR; functionally homologous to mammalian PITPs
Stentor Coeruleus SteCoe_7122 1.1089390193121365e-40
Description: None
WormBase WBGene00011962 2.9995979253168707e-35
Description: CRAL-TRIO domain-containing protein T23G5.2 status:Confirmed UniProt:Q03606 protein_id:CAJ76964.1
DictyBase DDB_G0270022 7.997402223525235e-19
Description: DDB_G0270022 on chromosome: 1 position 4041315 to 4042649

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00292140(coding)
ATGGACAATAATAAGAACTCAGGAAATGTTGGAGAGTGTTCTCAAGAATAGTTAGATACA
TTGCAAAAATTTAGGCAATTTACTGCAATGAAAGGATGTTCTGAAAAAGAATATGACGAC
CACTACTTATTGAGATTTTTAAGAGCAAGAAAATTTGATTTAGTCAAAACAGAAAAGATG
TTTTCTGACTTTTTGGATTGGAGAATAAAGAATGATGTTTAAAATATAATGAAATTCTCC
TTCAATGAATTAGCTGAAGTTCGTCACCATTACCCTCATGGTTATCACAAAACTGATAAA
CTAGGTCGCCCAATATATATCGAAAGAATCGGAATGTTAAAGCTAACTCAACTATTTTAA
GTAACAACCGAAGAGCGTTTAATAAAGTATTATATCCAATCATACGAAATTCTCTTAAAT
CGTATCTTTCCTACTTGTTCACAAGCTATCGGACATAGAGTCGATTAAACAGTTACTATT
TTAGATTTAAAGGGTATTCCCATGAAAATGCTTTCAAAATAAGTTTATAATTTTATCTAG
CTTGCCTCTAAGGTAGCCTAAGAAAACTATCCTGAAATTCTTGGAAGAATGTTTATAGTA
AATGCTCCCATGCTATTTTCAGGAGTCTGGGCAGTTATAAAACCTTGGATAGATGAAAAA
ACAAGAAATAAAATTACAATTATAGGTTCAGGATTCAAAGAAAAGCTCTTAGAAATAATT
GATATTGATAACATTCCTGATTTTTTGGGAGGAAATAGCAAGTGTGATCTATCTAAAAAT
ATTGGACCTTGGAATCCTACTGGAGAAACTCCATTATTCCCATGCGAGTACAAAGATGGA
ATGAAATAAGATGGTGAAGAAGAAAAAGTAGTTTAAGATGGAGAAGAAGACGAAGATAGT
GAAGCTGAAAGATAAGCAATGGAATTAGCAGCTCTTAGAGATGCTTTAGCAGGTAAAATT
ACAGGACCTTCTTCCAAAGCTCCTCATAACCCAGATAAATACGAATTAACTACTTAAGGT
GCTAAATTCTAAGTCAGTGACACTCCTTTAAATACATAAGCTGAGGCTGATGATGACAAC
TGA


>TTHERM_00292140(gene)
ATGGACAATAATAAGAACTCAGGGTAATTAATTTAAAAATTAGTCTATGAAAATTACTAT
TAAAGACGATTGATTTTTTTTTTCTTTTTAAATTCAGAAATGTTGGAGAGTGTTCTCAAG
AATAGTTAGATACATTGCAAAAATTTAGGCAATTTACTGCAATGAAAGGATGTTCTGAAA
AAGAATATGACGACCACTACTTATTGAGATTTTTAAGAGCAAGAAAATTTGATTTAGTCA
AAACAGAAAAGATGTTTTCTGACTTTTTGGATTGGAGAATAAAGAATGATGTTTAAAATA
TAATGGTAATTTATTTTCATTTACATTTCTCCTTTTCAAAAGGAAGAATAAATAAATAAA
TCAAGAAGAGAAAATGGAATCAAAAGTGAATCATTTTTAATATGAAACTCATTTTAAAAT
TTAACTATTCATAAAAAGCATTTGCTTTAAGCTTATTGATAGCTTTAAGTATTATTTTTT
AATAAATAGAAATTCTCCTTCAATGAATTAGCTGAAGTTCGTCACCATTACCCTCATGGT
TATCACAAAACTGATAAACTAGTAATAAATCATTTAAATTTTAACTTAGTAAAATAGAAA
AAAAGATAGGAAATAGTCAAGCAAAAATATTTAGGAAATACTAAGCAGAGTATTTAAAGA
AATCGAAATTAAAAATTATTATAATTATTCATAGCATTTAAAAATAGCATAAATACTTAA
GAAAATTTTTAATTTAGCAATCATTTTTAAATTTAAAAAAATATAATCAAACAGGGTCGC
CCAATATATATCGAAAGAATCGGAATGTTAAAGCTAACTCAACTATTTTAAGTAACAACC
GAAGAGCGTTTAATAAAGTATTATATCCAATCATACGAAATTCTCTTAAATCGTATCTTT
CCTACTTGTTCACAAGCTATCGGACATAGAGTCGATTAAACAGTTACTATTTTAGATTTA
AAGGGTATTCCCATGAAAATGCTTTCAAAATAAGTTTATAATTTTATCTAGCTTGCCTCT
AAGGTAGCCTAAGAAAACTATCCTGAAATTCTTGGAAGAATGTTTATAGTAAATGCTCCC
ATGCTATTTTCAGGAGTCTGGGCAGTTATAAAACCTTGGATAGATGAAAAAACAAGAAAT
AAAATTACAATTATAGGTTCAGGATTCAAAGAAAAGCTCTTAGAAATAGTAATTAATTAA
TAAATTAATTCTATTCTATTTTAATCTTTTATTTAATTAAAATATCAATTTATTTATTTA
CTTACTCAATAACTATATATTTATTTTAATATTTTTAATTCAGATTGATATTGATAACAT
TCCTGATTTTTTGGGAGGAAATAGCAAGTGTGATCTATCTAAAAATATTGGACCTTGGAA
TCCTACTGGAGAAACTCCGTAAATTTAAATTAAATTAATATTAATACCAATTCATTTTTT
TATTTTTGATTGTACTGATTATTTTTTTTTGCTCCATCAAATATAAATAAATATTATTAA
ATAATTAAAAATACATTTAAATTTCTAATTAAAGATATGAGCCCCAAATCATAACAATTA
TTATTAAATTAATTATTACTATTTTAATATAAAGATTATTCCCATGCGAGTACAAAGATG
GAATGAAATAAGATGGTGAAGAAGAAAAAGTAGTTTAAGATGGAGAAGAAGACGAAGATA
GTGAAGCTGAAAGATAAGCAATGGAATTAGCAGCTCTTAGAGATGCTTTAGCAGGTAAAA
TTACAGGACCTTCTTCCAAAGCTCCTCATAACCCAGATAAATACGAATTAACTACTTAAG
GTGCTAAATTCTAAGTCAGTGACACTCCTTTAAATACATAAGCTGAGGCTGATGTAATTT
TTTTTAATTTATATAAATTTGAAATATAAAATTGAAAATTGATTTTTGAGATAGAAAATC
TAAAGAAAAATTATAGTGAAAAGTCATTATTAGAAAAAATTAAATAGATAAAAATTAATT
TAGATTAAAAAACTAAGCAATAGCATTAAATATATATTAAAGAGTAAAGCGATGAAATTG
AATAATAAGCTAAATTGAAAAATATAAATTTCTTTAAGCAAATTGCAAACATACTTTTTT
AGAATAAAAATATTATATAAATATGAAATATCTACAATAAAAATAAATTAATAAGAAAGC
AAAATAATACAATTATTAGATAAAATATAGTTAAAATTTTATTAATTTAGAATTTTATAA
ATGAAATTGCATGCAACAAATATATTTATAATTATTTATTTTATTAATGAGCAAAAAATA
TATTTAAAATAATTTATTTATTTAATTTATTAAAAAAAAGGATGACAACTGA


>TTHERM_00292140(protein)
MDNNKNSGNVGECSQEQLDTLQKFRQFTAMKGCSEKEYDDHYLLRFLRARKFDLVKTEKM
FSDFLDWRIKNDVQNIMKFSFNELAEVRHHYPHGYHKTDKLGRPIYIERIGMLKLTQLFQ
VTTEERLIKYYIQSYEILLNRIFPTCSQAIGHRVDQTVTILDLKGIPMKMLSKQVYNFIQ
LASKVAQENYPEILGRMFIVNAPMLFSGVWAVIKPWIDEKTRNKITIIGSGFKEKLLEII
DIDNIPDFLGGNSKCDLSKNIGPWNPTGETPLFPCEYKDGMKQDGEEEKVVQDGEEDEDS
EAERQAMELAALRDALAGKITGPSSKAPHNPDKYELTTQGAKFQVSDTPLNTQAEADDDN