Identifiers and Description

Gene Model Identifier

TTHERM_00293270

Standard Name

CYC7 (CYClin 7)

Aliases

PreTt15537 | 27.m00197 | 3692.m00001

Description

CYC7 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein; regulates activity of cyclin-dependent kinases; expressed during growth phase and conjugation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08686.1 9.997093137033517e-262
Description: cyclin domain-containing protein (405 aa)
Oxytricha Contig14947.0.g37 1.9998745702418095e-48
Description: Cyclin, N-terminal domain
DictyBase DDB_G0279085 0.000000000000005001692698841201
Description: cycA on chromosome: 3 position 1598641 to 1600602
WormBase WBGene00000865 0.00000000000001000191320216021
Description: locus:cyb-1 G2/mitotic-specific cyclin-B1 status:Confirmed UniProt:Q10653 protein_id:CAA94384.1
SGD YPR120C 0.00000000000020009182674645818
Description: CLB5 B-type cyclin involved in DNA replication during S phase; activates Cdc28p to promote initiation of DNA synthesis; functions in formation of mitotic spindles along with Clb3p and Clb4p; most abundant during late G1 phase
Stentor Coeruleus SteCoe_20066 0.0000000000018795288165390832
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00293270(coding)
ATGAATTCCTAAGTAGAAATATAATCTATGCCTTCTGAATAGACCTTCTTATCTTATGAA
AATGCCTGCCACGCTGGAGTTTAGTAGAAGTTCTACAACAATTCTTTAGCCTAAAAGAGT
GCTGCTGGTTTCCGTGGAGGTGAGTGCATCCGTAAGAAAGCTAAGAACTGTTAAATTAAT
ATTGTCAATCCTCAAAAAGAAATATCTGCTGCTGATTGTATGGAAATTGAAGATGATTGC
AATTTGAAGTAAAAATAAAACTTTGAGCAGTAATAGTAGCAAGATTAAAGAACAACCGAG
TGCAATTCTTTTTCTGACTACTTTACCAGCAAAAGATTTTAATAAATTTAAGTTCTATTA
AAGAGCGCTTCCAACGAAGAAGCTTACTCATCTAGAATAATTTCTTCTATGATTAATAGT
TAAAAATCACCAAGTGACTTCTTGCAAAACCACACAATAACTCCTGAAATAAGAGCAAAG
ATGATTGACTGGATGATTGAGGTTACAACAAGCTATGGTTAGAGTGATTAAACCTTCTTC
TTGGCAGTACAATACATGGACGCATTTTTCTAAAACTCTTAAAGATAGTTAACTCCTCAA
GATTTACATTTGACTGGTGTTGCTAGCATGTTTATTGCCTGCAAATATGAAGAAATATAT
CCTCTTCGTCTCTAAACCTTCTATGAAAAAATTGGTCACAAGAAATTGTCTATTTCAGAT
ATCAAGTAAAGAGAACAAGAAATATTGGCCTCTATAGATTTTGATTTAAGTTCTCCCACT
ATCCTTGACTTTATGGCTGTAACAGTCCAAAAATTAAATTTAGAAGAACACCTTCTTGAC
ACACATCTTACTTTTTTCCGTAAAATGTGTATTTACCTTGCAAAAATGGTATCACATGAA
TATTCTATCATTAATAACCATAACCAAACTACTATTGCTGGAGCAATTATCTATGTTTCT
TTTAAAATCCTTTAATAAATGTACAATGAATTTAATCTTGTTGCCCTTATACAACAAGTT
ATCTAAATTCTAAGCTTAAACAATGAAGAAATTCTTAAGGCTTCTACTCTTTTGCTTAAT
CTTGCAAGAAGTTTTGAGAGATAATATCCTAACTTGAATAATTTAAGAAAATTTAGTGCA
GATATCCAATAAATAAGTGCTTCTCCCTCTTCATCTTCACTAAAACCAACAAACCAATAA
CAAAGAAGAGCAAATAACTGA


>TTHERM_00293270(gene)
ATGAATTCCTAAGTAGAAATATAATCTATGCCTTCTGAATAGACCTTCTTATCTTATGAA
AATGCCTGCCACGCTGGAGTTTAGTAGAAGTTCTACAACAATTCTTTAGCCTAAAAGAGT
GCTGCTGGTTTCCGTGGAGGTGAGTGCATCCGTAAGAAAGCTAAGAACTGTTAAATTAAT
ATTGTCAATCCTCAAAAAGAAATATCTGCTGCTGATTGTATGGAAATTGAAGATGATTGC
AATTTGAAGTAAAAATAAAACTTTGAGCAGTAATAGTAGCAAGATTAAAGAACAACCGAG
TGCAATTCTTTTTCTGACTACTTTACCAGCAAAAGATTTTAATAAATTTAAGTTCTATTA
AAGAGCGCTTCCAACGAAGAAGCTTACTCATCTAGAATAATTTCTTCTATGATTAATGTA
AACAATTAATTTCATTTATCTACTTAATAATTCCATTTTTAAGTATTTCCGATGACTTAT
TTTCTATTGTTAATTTATTAATTTACTTATTAACAAACATATCAGCATTCAATTAATTCT
CCCCAATTTTTGAAATTCACATTCATTTGCAAATTAAATTTTTAATCTTGATATGCTTGC
TTGTCTCACCCATTATTAAATAGATACTAAATTTTTTAATTAATTAATTAATATTTTCTT
TGGATATGAAAATCAATACAATACAACACAACACAACACTATCATCTTTTAATAGCAGTA
TTCTATCTATTTTGCTAATTATCATACTCTTTTTAAGACATATGGATTACTTATTTATGA
TATAAAAAATTTGAAAAAATCTATAAATCTGATTATTGGATTAATCCAAATCATTATCTA
AAAATCTTAAGATTTATATTCATTTTTTTTTATAACATTCATAGAGTTAAAAATCACCAA
GTGACTTCTTGCAAAACCACACAATAACTCCTGAAATAAGAGCAAAGATGATTGACTGGA
TGATTGAGGTTACAACAAGCTATGGTTAGAGTGATTAAACCTTCTTCTTGGCAGTACAAT
ACATGGACGCATTTTTCTAAAACTCTTAAAGGTAATTAAAATTAATTTAAAAAAATATTT
TTTGATATCAAAGTTGATTACTGATTTAAAGTTAATTTGATTAACACTATAACTTTTCCC
ATATTAAATTCTAATATTTTTAAAATCCGTCACATTTCTAATTCTAAATGATTAAATTAG
ATCATTTAATATTATTTCCCTCCATAAAGTTTGCATAAAAACGCTAATTTATTAAAAATT
AACACAATAAAGAAATTTAAAATTTTTCAATTCTTTTTGATAATAATTATTATTATTTTG
CATTCAATCTTTCCTTCCTTCCCGACCTTATTTAATTAATTAATTAAATAAATAAATAAA
AAATAATTAATAATACTGATAATTCCTAAATAAAAATTTTTCCTTTCTAGGTTTTTAACA
TGTTTTAATTTTAATATTTTAAATATTAATAGATAGTTAACTCCTCAAGATTTACATTTG
ACTGGTGTTGCTAGCATGTTTATTGCCTGCAAATATGAAGAAATATATCCTCTTCGTCTC
TAAACCTTCTATGAAAAAATTGGTCACAAGAAATTGTCTATTTCAGATATCAAGTAAAGA
GAACAAGAAATATTGGCCTCTATAGATTTTGATTTAAGTTCTCCCACTATCCTTGACTTT
ATGGCTGTAACAGTCCAAAAATTAAATTTAGAAGAACACCTTCTTGACACACATCTTACT
TTTTTCCGTAAAATGTGTATTTACCTTGCAAAAATGGTATCACATGAATATTCTATCATT
AATAACCATAACCAAACTACTATTGCTGGAGCAATTATCTATGTTTCTTTTAAAATCCTT
TAATAAATGTACAATGAATTTAATCTTGTTGCCCTTATACAACAAGTTATCTAAATTCTA
AGCTTAAACAATGAAGAAATTCTTAAGGCTTCTACTCTTTTGCTTAATCTTGCAAGAAGT
TTTGAGAGATAATATCCTAACTTGAATAATTTAAGAAAATTTAGTGCAGATATCCAATAA
ATAAGTGCTTCTCCCTCTTCATCTTCACTAAAACCAACAAACCAATAACAAAGAAGAGCA
AATAACTGA


>TTHERM_00293270(protein)
MNSQVEIQSMPSEQTFLSYENACHAGVQQKFYNNSLAQKSAAGFRGGECIRKKAKNCQIN
IVNPQKEISAADCMEIEDDCNLKQKQNFEQQQQQDQRTTECNSFSDYFTSKRFQQIQVLL
KSASNEEAYSSRIISSMINSQKSPSDFLQNHTITPEIRAKMIDWMIEVTTSYGQSDQTFF
LAVQYMDAFFQNSQRQLTPQDLHLTGVASMFIACKYEEIYPLRLQTFYEKIGHKKLSISD
IKQREQEILASIDFDLSSPTILDFMAVTVQKLNLEEHLLDTHLTFFRKMCIYLAKMVSHE
YSIINNHNQTTIAGAIIYVSFKILQQMYNEFNLVALIQQVIQILSLNNEEILKASTLLLN
LARSFERQYPNLNNLRKFSADIQQISASPSSSSLKPTNQQQRRANN