Identifiers and Description

Gene Model Identifier

TTHERM_00293380

Standard Name

CRN1 (CoRoNin 1)

Aliases

PreTt15548 | 27.m00208 | 3692.m00012

Description

coronin; Coronin protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF08047 ) histidine operon leader peptide
  • ( PF08953 ) Domain of unknown function (DUF1899)
  • ( PF08954 ) Domain of unknown function (DUF1900)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08696.1 9.997093137033517e-262
Description: hypothetical protein (825 aa)
SGD YLR429W 2.0001081030036656e-67
Description: CRN1 Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity; plays a role in regulation of actin patch assembly
DictyBase DDB_G0267382 9.996162112727537e-67
Description: corA on chromosome: 1 position 943374 to 944711
Oxytricha Contig3627.0.g26 5.998566275848171e-59
Description: Domain of unknown function (DUF1900)
WormBase WBGene00000768 3.9998411574835458e-50
Description: locus:cor-1 Coronin-like protein cor-1 status:Confirmed UniProt:Q21624 protein_id:CAD27604.1
Stentor Coeruleus SteCoe_19728 3.3057006267607343e-37
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00293380(coding)
ATGGCTCAAAAGTTTAGATTTAGAAATCTTTTCGCAAAATCTCACACAAAGTGGGAGGAC
ATTTAACCTTTAGGTGGTGCTACTGATGGTTATATAATAGCAGGTAACTCTAAGTTCATA
GCTTTCCCCCTTCAAGGTGGTATGGGAAGCACTTTAGGTGTATTAAGCTATAAGCAATCT
GGAAGAGTCAAACAAATTTCTTAAATTAGGGCCCATACTTCTCACATTACTGATTTCAAG
TTTTTGCCTTACTAAGAAAACACTGTAGCTACTGCTTCTTAAGATGCAACCATTAAGTTT
TGGCACATTGATGATGATAATAGCAAAGATATTGACACTCCATTAACTACACTATCTGGA
CATGCTCTTAAAATCAATTTGATTGCTCCCCATAACTCAGCTAAAGGTATATTAGCCTCT
GCATCGTATGACAAGACTATCAAGGTTTGGAATACTGAAGAAAGCAAAGATGTACTTACT
ATTAACTAAGGTAGTAACTATGCTCTTTGCTTAGAGTGGTCCCACGATGGATCAATCCTA
GGTTCTACATGGAATGATAAACAAGTAAGAATTATTGATCCTAGGTAATAAACATTTGTT
AAAGAATTCGGAGCTCATCAAAGCACCAGAGCATAAAAAATGGCCTTTTTAGGTAATACA
AGTTACTTCGTAACTACAGGTTTTGACCAAGTATAAAAGAGATAGCTTTTCCTTTGGGAT
ATTCGTAATACCTCAAGCAATATCAAAGTAGAAGGCTGTTCTTAAGCTTAAGGTGTTCTC
CATCCCTACTATGATAGCGATTTAGGTATTTTATATCTAAATGGTAAAGGTGAAGGCTTA
GTCCGCTTATTTGAATACCAAAACGGAACTCTCACAACTCATTAAAATGATGTCATGGTT
ACTGATACTACTAAGGGATATGGTTTCTTACCTAAGTATGCTGTAGACACACATTAGAAT
GAAGTTTGTAGATTAGTAAAATTATGTAGCAAATACGCTGAAGCAGTTTCTATCATTTAT
CCTAGAAGAAGTTAAGACTTTTAAGAAGATCTCTATCCAGATTGCTCTATTGACTTTAGC
TTGACAGCTCAATAATGGCTTGAAGGTTAAAATGCTTAACCTAAAGTTGCTGCCATGAAG
GATTTAAAGTTGTCTAACCACACTCATCATAGTAAGCCTGCTACTACCACTCACAATTAA
ACTCTTTCTCATCAAGTTCACCATACTACTACCACTACTAATGTTACCCAACCTCAAAGA
AAATCAAGTAATACTTAAACTAGTCATACTACCCATCATGTTAAGACTGAAGCTAAGGTA
GAAGCTATTTCAGAAAAAGAAAATAGTCATCCAAACAATCAACAAGATGTAGAACACTAA
TAATTACAAAAAGCAATCGAAGAAAACAAAGATTATTTAGCTAAAAATGAAAACTTAAAG
AGTGATTTAGCTCAAAAAGATGCCGAAATTACTGAATTAAAGAGCTAAGTTGAGTATTTA
CATCTTTAAGTTTAGGAAAGAATATAGAATGAGTAAAGTGTTAGTGTTTTGACTTAAGAA
GTAGAATAATTAAAACAAAACTTGGTTTAAAGTGAAACCTAAAATACTGAGCTTAAAGAA
TAATTGCAAGCATAAACAGTTACTTTCTAATAAGAAAAAGAATTGCTTAACTTGCAAATT
CAAGAATTTAAATAAAAATATTAAGACTGCATTCAATTAGTATAAACTTTAAGCCAATAA
GAAGTAAGTCTTGAAGGACTTGAGCATGATTAACTTCTTTAATCTCTCAGATCTCTTGCT
GAAAAAGGCGAATAGAACTCTTAACTTTGA


>TTHERM_00293380(gene)
ATGGCTCAAAAGTTTAGATTTAGAAATCTTTTCGCAAAATCTCACACAAAGTGGGAGGAC
ATTTAACCTTTAGGTGGTGCTACTGATGGTTATATAATAGCAGGTAACTCTAAGTTCATA
GCTTTCCCCCTTCAAGGTGGTATGGGAAGCACTTTAGGTGTATTAAGCTATAAGCAATCT
GGAAGAGTCAAACAAATTTCTTAAATTAGGGCCCATACTTCTCACATTACTGATTTCAAG
TTTTTGCCTTACTAAGAAAACACTGTAGCTACTGCTTCTTAAGATGCAACCATTAAGTTT
TGGCACATTGATGATGATAATAGCAAAGATATTGACACTCCATTAACTACACTATCTGGA
CATGCTCTTAAAATCAATTTGATTGCTCCCCATAACTCAGCTAAAGGTATATTAGCCTCT
GCATCGTATGACAAGACTATCAAGGTAAATACTTTAAATTCTTTTTTTAAAATCAGTCAT
TAATATTACTCTTATAACCTAACATTTTTAAAATAGCTAATTAACTTTTTTAAATATTAA
TTTAGGTTTGGAATACTGAAGAAAGCAAAGATGTACTTACTATTAACTAAGGTAGTAACT
ATGCTCTTTGCTTAGAGTGGTCCCACGATGGATCAATCCTAGGTTCTACATGGAATGATA
AACAAGTAATATTATTATTTAAAGTTGACTCCTTCATTAATATTAAGAAGCTAGACTTTT
ATAAGACTTTTATGATGGAATTGATTATTCTTTAATGCAGACTATTGATTTAAGGTTAAT
AAAAATTCTTTTATTTTAAAATAAAAATAGGTAAGAATTATTGATCCTAGGTAATAAACA
TTTGTTAAAGAATTCGGAGCTCATCAAAGCACCAGAGCATAAAAAATGGCCTTTTTAGGT
AATACAAGTTACTTCGTAACTACAGGTTTTGACCAAGTATAAAAGAGATAGCTTTTCCTT
TGGGATATTCGTAATACCTCAAGCAATATCAAAGTAGAAGGCTGTTCTTAAGCTTAAGGT
GTTCTCCATCCCTACTATGATAGCGATTTAGGTATTTTATATCTAAATGGTAAAGGTGAA
GGCTTAGTCCGCTTATTTGAATACCAAAACGGAACTCTCACAACTCATTAAAATGATGTC
ATGGTTACTGATACTACTAAGGTAAAATATCTTATCAAATTTTATAATAAGAAGATATAT
CTTAATTGAGAATTTAAAGTACTTTAGGATTTTATCAATGCTTTTAATATAAAATGAATG
AAAACTTATTAGCAATAATTAATCCTTCAAAGTTTTATATAAATGAATTTAGTTATTTTT
GAATGATGAAAATAAATAATCTAAATTTATAACATGTATACTAACTAATTGCAAATTTAT
TAAAATTAAAGGGATATGGTTTCTTACCTAAGTATGCTGTAGACACACATTAGAATGAAG
TTTGTAGATTAGTAAAATTATGTAGCAAATACGCTGAAGCAGTTTCTATCATTTATCCTA
GAAGAAGTTAAGACTTTTAAGAAGATCTCTATCCAGATTGCTCTATTGACTTTAGCTTGA
CAGCTCAATAATGGCTTGAAGGTTAAAATGCTTAACCTAAAGTTGCTGCCATGAAGGATT
TAAAGTTGTCTAACCACACTCATCATAGTAAGCCTGCTACTACCACTCACAATTAAACTC
TTTCTCATCAAGTTCACCATACTACTACCACTACTAATGTTACCCAACCTCAAAGAAAAT
CAAGTAATACTTAAACTAGTCATACTACCCATCATGTTAAGACTGAAGCTAAGGTAGAAG
CTATTTCAGAAAAAGAAAATAGTCATCCAAACAATCAACAAGATGTAGAACACTAATAAT
TACAAAAAGCAATCGAAGAAAACAAAGATTATTTAGCTAAAAATGAAAACTTAAAGAGTG
ATTTAGCTCAAAAAGATGCCGAAATTACTGAATTAAAGAGCTAAGTTGAGTATTTACATC
TTTAAGTTTAGGAAAGAATATAGAATGAGTAAAGTGTTAGTGTTTTGACTTAAGAAGTAG
AATAATTAAAACAAAACTTGGTTTAAAGTGAAACCTAAAATACTGAGCTTAAAGAATAAT
TGCAAGCATAAACAGTTACTTTCTAATAAGAAAAAGAATTGCTTAACTTGCAAATTCAAG
AATTTAAATAAAAATATTAAGACTGCATTCAATTAGTATAAACTTTAAGCCAATAAGAAG
TAAGTCTTGAAGGACTTGAGCATGATTAACTTCTTTAATCTCTCAGATCTCTTGCTGAAA
AAGGCGAATAGAACTCTTAACTTTGA


>TTHERM_00293380(protein)
MAQKFRFRNLFAKSHTKWEDIQPLGGATDGYIIAGNSKFIAFPLQGGMGSTLGVLSYKQS
GRVKQISQIRAHTSHITDFKFLPYQENTVATASQDATIKFWHIDDDNSKDIDTPLTTLSG
HALKINLIAPHNSAKGILASASYDKTIKVWNTEESKDVLTINQGSNYALCLEWSHDGSIL
GSTWNDKQVRIIDPRQQTFVKEFGAHQSTRAQKMAFLGNTSYFVTTGFDQVQKRQLFLWD
IRNTSSNIKVEGCSQAQGVLHPYYDSDLGILYLNGKGEGLVRLFEYQNGTLTTHQNDVMV
TDTTKGYGFLPKYAVDTHQNEVCRLVKLCSKYAEAVSIIYPRRSQDFQEDLYPDCSIDFS
LTAQQWLEGQNAQPKVAAMKDLKLSNHTHHSKPATTTHNQTLSHQVHHTTTTTNVTQPQR
KSSNTQTSHTTHHVKTEAKVEAISEKENSHPNNQQDVEHQQLQKAIEENKDYLAKNENLK
SDLAQKDAEITELKSQVEYLHLQVQERIQNEQSVSVLTQEVEQLKQNLVQSETQNTELKE
QLQAQTVTFQQEKELLNLQIQEFKQKYQDCIQLVQTLSQQEVSLEGLEHDQLLQSLRSLA
EKGEQNSQL