Identifiers and Description

Gene Model Identifier

TTHERM_00294690

Standard Name

PARG1 (Poly(ADP-Ribose) Glycohydrolase 1)

Aliases

PreTt15579 | 27.m00239 | 3692.m00042

Description

poly(ADP-ribose) glycohydrolase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

  • type II site-specific deoxyribonuclease complex (IEA) | GO:0009359

Biological Process

Domains

  • ( PF05028 ) Poly (ADP-ribose) glycohydrolase (PARG)
  • ( TIGR01741 ) conserved hypothetical protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08724.1 9.997093137033517e-262
Description: poly (ADP-ribose) glycohydrolase (PARG) (459 aa)
DictyBase DDB_G0277943 1.9993430003514377e-39
Description: parG on chromosome: 3 position 42510 to 44486
Oxytricha Contig14723.0.g46 6.0018235484001396e-36
Description: Poly (ADP-ribose) glycohydrolase (PARG)
WormBase WBGene00004052 9.99893167504554e-35
Description: locus:pme-4 Poly(ADP-ribose) glycohydrolase pme-4 status:Confirmed UniProt:Q9N5L4 protein_id:CCD68980.1
Stentor Coeruleus SteCoe_18976 3.1391327920480296e-17
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00294690(coding)
ATGATCGAAGCGGAAAAATAAGAAAATAAAAAAATCTAAGATTATTAATTTCCATTACCA
TAAAAAAATAGTGAACTTTGGATAATTTAAAAAAAAACTCTCTAAGATTTAAGCTCAGGA
AAATAAAAACTAGATAGCTTTTAATCTCTAGAGTCTATTTTAGAAATATTGAGAGACAGT
AAAAACTAAAACGATGAGAAGTATTTTAACCTAAAAGCTGTATTTGAATAGCTTGATAAA
GAAGAGCAAACATATTTCTTGGAATAGTTCATTCCTAAAATATGCTAGCTTGTTCTAAAA
ATTAAAAAGAAGTAATTAAAAAATTAGATTCCAAAAGAATCTAAGATTTATGAAGCTGCT
TTCTCTAGAGAAGAAATATCTTACTATGTTAGCTGTATGTTTTTATGTATACTCAAAGAC
TAAGACAGAAAAATATATAAAGATTTTAGATTAATATACCTCAAAGACCTAGTGTAATAA
ATTAACATACGCAGATAAGAAAAAATAAAATGCTTTTATGAATACTTGAAGCAAGCTTTA
GACTTTTCGGAAAAAGAATCTAAAGAGGTGGTTATCTTCTAAAGAATTAATTGTGGTCAA
TTAGAAGATTATGAAAATTGGGTTGACAAATTAAAGGCTATTAAGTTAAAAAATGTTTAA
CTAACAGATGATAAGCTAATCGAAGACTTTCCAGGTACCCTTCAAGTAGATTTTGCAAAT
TGTGATATAGGGGGAGGTATTTTAGGTAATGGATTGGTTTAAGAAGAAATAAGATTTTGT
GTATGTCCTGAAATGTTAGTAAGCTTGCTAGTTTTTGATTAATCTATGGAAGCAAATGAA
GTAATTATAATGAAAGGAATTAAATAGTATTCTGATTATTAAGGTTATAGTAATTCATTT
AGATTCGTTAAAATGGGAAATTCTAAGATTTAAAAGTAGAAAAGAAACAACCCTTAAACG
ATATTAGCTATAGATGCACTATGTTTCAATAGCTCTGACAATTAATTTTCTGAAGTAAAT
GTTAGCAGAGAGCTTAATAAATCGTATATGGGATTTAAATAAGAAGATTAATTAAAAACA
ATTTCAACTGGTAAATGGGGATGTGGTGCATTTCTAGGTGTATTTGATTTAAAATTTGCA
ATTCAGTGGATAGCATCCAGTAGATCAAATAAAAAAATGATAATATGTACTTTTTAAGAT
GAACAAACTACAAAATAAATCTAATAAGTTTTTGATCTTTACAAATAAAAGAATGCTTCA
ATTTTTTTGAAGCTTGTTATGGATTATCCAAACTCTAAATACATGGAGGATTACACGCTT
TTAGAATACTTAATAGAATTAGGAAAAGAAAAAGCAACATCAAAAAATTCTTGA


>TTHERM_00294690(gene)
ATGATCGAAGCGGAAAAATAAGAAAATAAAAAAATCTAAGATTATTAATTTCCATTACCA
TAAAAAAATAGTGAACTTTGGATAATTTAAAAAAAAACTCTCTAAGATTTAAGCTCAGGA
AAATAAAAACTAGATAGCTTTTAATCTCTAGAGTCTATTTTAGAAATATTGAGAGACAGT
AAAAACTAAAACGATGAGAAGTATTTTAACCTAAAAGCTGTATTTGAATAGCTTGATAAA
GAAGAGCAAACATATTTCTTGGAATAGTTCATTCCTAAAATATGCTAGCTTGTTCTAAAA
ATTAAAAAGAAGTAATTAAAAAATTAGATTCCAAAAGAATCTAAGATTTATGAAGCTGCT
TTCTCTAGAGAAGAAATATCTTACTATGTTAGCTGTATGTTTTTATGTATACTCAAAGAC
TAAGACAGAAAAATATATAAAGATTTTAGATTAATATACCTCAAAGACCTAGTGTAATAA
ATTAACATACGCAGATAAGAAAAAATAAAATGCTTTTATGAATACTTGAAGCAAGCTTTA
GACTTTTCGGAAAAAGAATCTAAAGAGGTGGTTATCTTCTAAAGAATTAATTGTGGTCAA
TTAGAAGATTATGAAAATTGGGTTGACAAATTAAAGGCTATTAAGTTAAAAAATGTTTAA
CTAACAGATGATAAGCTAATCGAAGACTTTCCAGGTACCCTTCAAGTAGATTTTGCAAAT
TGTGATATAGGGGGAGGTATTTTAGGTAATGGATTGGTTTAAGAAGAAATAAGATTTTGT
GTATGTCCTGAAATGTTAGTAAGCTTGCTAGTTTTTGATTAATCTATGGAAGCAAATGAA
GTAATTATAATGAAAGGAATTAAATAGTATTCTGATTATTAAGGTTATAGTAATTCATTT
AGATTCGTTAAAATGGGAAATTCTAAGATTTAAAAGTAGAAAAGAAACAACCCTTAAACG
ATATTAGCTATAGATGCACTATGTTTCAATAGCTCTGACAATTAATTTTCTGAAGTAAAT
GTTAGCAGAGAGCTTAATAAATCGTATATGGGATTTAAATAAGAAGATTAATTAAAAACA
ATTTCAACTGGTAAATGGGGATGTGGTGCATTTCTAGGTGTATTTGATTTAAAATTTGCA
ATTCAGTGGATAGCATCCAGTAGATCAAATAAAAAAATGATAATATGTACTTTTTAAGAT
GAACAAACTACAAAATAAATCTAATAAGTTTTTGATCTTTACAAATAAAAGAATGCTTCA
ATTTTTTTGAAGCTTGTTATGGATTATCCAAACTCTAAATACATGGAGGATTACACGCTT
TTAGAATACTTAATAGAATTAGGAAAAGAAAAAGCAACATCAAAAAATTCTTGA


>TTHERM_00294690(protein)
MIEAEKQENKKIQDYQFPLPQKNSELWIIQKKTLQDLSSGKQKLDSFQSLESILEILRDS
KNQNDEKYFNLKAVFEQLDKEEQTYFLEQFIPKICQLVLKIKKKQLKNQIPKESKIYEAA
FSREEISYYVSCMFLCILKDQDRKIYKDFRLIYLKDLVQQINIRRQEKIKCFYEYLKQAL
DFSEKESKEVVIFQRINCGQLEDYENWVDKLKAIKLKNVQLTDDKLIEDFPGTLQVDFAN
CDIGGGILGNGLVQEEIRFCVCPEMLVSLLVFDQSMEANEVIIMKGIKQYSDYQGYSNSF
RFVKMGNSKIQKQKRNNPQTILAIDALCFNSSDNQFSEVNVSRELNKSYMGFKQEDQLKT
ISTGKWGCGAFLGVFDLKFAIQWIASSRSNKKMIICTFQDEQTTKQIQQVFDLYKQKNAS
IFLKLVMDYPNSKYMEDYTLLEYLIELGKEKATSKNS