Identifiers and Description

Gene Model Identifier

TTHERM_00294860

Standard Name

CYC33 (CYClin 33)

Aliases

PreTt15596 | 27.m00256 | 3692.m00059

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08745.1 1.999382702437002e-145
Description: hypothetical protein (278 aa)
DictyBase DDB_G0277481 0.000000000000004001928599951003
Description: DDB_G0277481 on chromosome: 2 position 7953876 to 7955136
SGD YIL050W 0.000000019990673443141236
Description: PCL7 Pho85p cyclin of the Pho80p subfamily, forms a functional kinase complex with Pho85p which phosphorylates Mmr1p and is regulated by Pho81p; involved in glycogen metabolism, expression is cell-cycle regulated
Oxytricha Contig20637.0.g110 0.0000020007268868677913
Description: Cyclin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00294860(coding)
ATGACTGATCTATATCATGGAAATTCACCTGAACACTTTTTGAGTACTTGTGGAAGCGAC
AATTTTGATTCTATTGTAGCTAACTCAATCTCAGATAAAAACTGCACCCTTAAAGCCAAG
CAAATGTCATAGAGCTCTTTGTCATCTGTCTCAACTTCATCATCTTCCTTATCACAATCT
TCAATTATTGCTTAAAAGCCTTTAAACGCTGCTAAATATTAGCAAATTATTGAACAATTT
GACAAGCTAGAGAACAGCAATAAATCTAAATCAAGTTCTAAAAGCTCTATTTCATCTTCT
TAAATTTCTTAAAAGAAGATTAATGTTATTAAATTGACTGATTGGGTAGTCAACGACCTT
TGGAAGGATGCCTTTGAGCTCTACTAATTGTAGAATGAAGACGCTGAATACCTTGAGAAT
TGCTCCTTTTATTTAGAAGAAAACAAGCGCATTAAAATCTCATTTGCTTCTTATGTTAAA
AGACTTAAAGAACTAACTGAATGTTCTGATAATTGTTTCATTCTTGCCTTGTTACTCTTC
GATAGACTAAACAAGAAGAAGAAATTAAACTATAGTCGCATCAATGTTCACAAACTTATG
GCCATATGCCTTTGGTTGAGTGTCAAGTTCTATGAAGACATCAATTTCACTGATGCTTAC
TATGCACAAAAGATTGCTGGTATTCCTCTTGAGGAGCTCATTTCTCTTTAATTCGAACTT
CTCGAGCTTTTGAATTATAGATTATTCATTTCACCTCAAAGATTCAACCACTTCATGAAG
CTCATCAACTCTCTCATTCAATCTGGAGCTGTTAATGCTTGA


>TTHERM_00294860(gene)
ATGACTGATCTATATCATGGAAATTCACCTGAACACTTTTTGAGTACTTGTGGAAGCGAC
AATTTTGATTCTATTGTAGCTAACTCAATCTCAGATAAAAACTGCACCCTTAAAGCCAAG
CAAATGTCATAGAGCTCTTTGTCATCTGTCTCAACTTCATCATCTTCCTTATCACAATCT
TCAATTATTGCTTAAAAGCCTTTAAACGCTGCTAAATATTAGCAAATTATTGAACAATTT
GACAAGCTAGAGAACAGCAATAAATCTAAATCAAGTTCTAAAAGCTCTATTTCATCTTCT
TAAATTTCTTAAAAGAAGATTAATGTTATTAAATTGACTGATTGGGTAGTCAACGACCTT
TGGAAGGATGCCTTTGAGCTCTACTAATTGTAGAATGAAGACGCTGAATACCTTGAGAAT
TGCTCCTTTTATTTAGAAGAAAACAAGCGCATTAAAATCTCATTTGCTTCTTATGTTAAA
AGACTTAAAGAACTAACTGAATGTTCTGATAATTGTTTCATTCTTGCCTTGTTACTCTTC
GATAGACTAAACAAGAAGAAGAAATTAAACTATAGTCGCATCAATGTTCACAAGTAATTT
ATTATTTTAATAAAATTTCATTTTAGTTTTTAAAATTTTACACATCTATGCTTTTCCATT
TATTTTTATTGAGGATAAATTTCATACGATCTGATTAGAACTAATAAAATATTCTTCCTG
GTTGATTTTTGCTACTGAAGCTCATTCAAGCTAAATAGAAATTTTAAGAGATGAAAAAAA
TATTAAATTCTGGACTTTAAAATTAAATGAATTTCGAATGAGAAGGAGTGGAAGAGAGAA
TAAATAAACTCGTGACTGAGCAAGGAAGGAATGAGGAGAAATAGGCGAAATTAACTGCAC
ACTCGAAAAAGAAATTTTCTGTTAATTGAGAGGAGTTATTAATTGATTGATTAGTTAGTT
AGTTAGTTAGTTATAGAACTTAAAGTAAGTAGATGTTTCAAAAAAAATCAAAGAGAGTGC
ATCTGCAAATTTTTGAAAAACCCCCCTTACTAAAAAAATGGATACTTTTATAATTTCCAC
TCAATTAATCAATATTTCTCCGCTAAAAAATAAAAACGTATGATTGATTGATTATTCTTA
TATAAAAGAGAGCTATCTCTCACTCTATTTTTCGCTACATCCTTCTATTCCAATATCAAA
AACTTATAAAAATAAATAGATTATCCCTCTGTATTTAACCTAAAAAATTAATTATAGAGC
CATTAACTTCACAATAAAAGCATAGATAACAAATATACAAATAAACAAACAATTCTATTT
TTCTTAACCATTAAATTAATCAATTTCTTATTATTAATATAGACTTATGGCCATATGCCT
TTGGTTGAGTGTCAAGTTCTATGAAGACATCAATTTCACTGATGCTTACTATGCACAAAA
GATTGCTGGTATTCCTCTTGAGGAGCTCATTTCTCTTTAATTCGAACTTCTCGAGCTTTT
GAATTATAGATTATTCATTTCACCTCAAAGATTCAACCACTTCATGAAGCTCATCAACTC
TCTCATTCAATCTGGAGCTGTTAATGCTTGA


>TTHERM_00294860(protein)
MTDLYHGNSPEHFLSTCGSDNFDSIVANSISDKNCTLKAKQMSQSSLSSVSTSSSSLSQS
SIIAQKPLNAAKYQQIIEQFDKLENSNKSKSSSKSSISSSQISQKKINVIKLTDWVVNDL
WKDAFELYQLQNEDAEYLENCSFYLEENKRIKISFASYVKRLKELTECSDNCFILALLLF
DRLNKKKKLNYSRINVHKLMAICLWLSVKFYEDINFTDAYYAQKIAGIPLEELISLQFEL
LELLNYRLFISPQRFNHFMKLINSLIQSGAVNA