Identifiers and Description

Gene Model Identifier

TTHERM_00295380

Standard Name

MED21 (Mediator subunit 21)

Aliases

PreTt15648 | 27.m00308 | 3692.m00111

Description

MED21 hypothetical protein; Subunit 21 of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08804.1 5.00115835552873e-49
Description: hypothetical protein (119 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00295380(coding)
ATGAATTAGGTTGTTTAATTAGAATAAACTATGAAGACATTTTTAAGAGACTTTTAGAAT
GCATTTAATCTAGTTCAAAACCCTCCCTAAGATTTAGATATGAATTATGTTGAAAATTAA
GCACGCTTTCTTTCATAATTAGCATAAGAAATGCAAAATGATATTAACAATCTTAAGCAA
ATTGATACATACACAGAAGAAGAGATAGAATAAAAAACTGAAAAATTATAGCAAGAAAGA
AAAATTGCTTTATAGCACTACTTAAGCTCTAAGGATGAAGCAGATAAATTAAATGAAAAC
TTGAAAGCAAATATAGATAACTTAGCTAATAAATTATACAGTCTAAATGAATGA


>TTHERM_00295380(gene)
ATGAATTAGGTTGTTTAATTAGAATAAACTATGAAGACATTTTTAAGAGACTTTTAGAAT
GCATTTAATCTAGTTCAAAACCCTCCCTAAGATTTAGATATGAATTATGTTGAAAATTAA
GCACGCTTTCTTTCATAATTAGCATAAGAAATGCAAAATGATATTAACAATCTTAAGCAA
ATTGATACATACACAGAAGAAGAGATAGAATAAAAAACTGAAAAATTATAGCAAGAAAGA
AAAATTGCTTTATAGCACTACTTAAGCTCTAAGGATGAAGCAGGTATGTTTATAAATTCA
AGTAAATTTAAAATTATTTAAATATTTTTCATTTTATAAAATAAGATAAATTAAATGAAA
ACTTGAAAGCAAATATAGATAACTTAGCTAATAAATTATACAGTCTAAATGAATGA


>TTHERM_00295380(protein)
MNQVVQLEQTMKTFLRDFQNAFNLVQNPPQDLDMNYVENQARFLSQLAQEMQNDINNLKQ
IDTYTEEEIEQKTEKLQQERKIALQHYLSSKDEADKLNENLKANIDNLANKLYSLNE