Identifiers and Description

Gene Model Identifier

TTHERM_00295920

Standard Name

MSH2 (mismatch repair gene )

Aliases

PreTt15702 | 27.m00362 | 3692.m00165

Description

MSH2 DNA mismatch repair MutS family DNA-binding domain protein putative; MutS domain III family protein; homolog to human MSH2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • photosynthetic electron transport in photosystem II (IEA) | GO:0009772
  • protein-FMN linkage via 1'-(8alpha-FMN)-L-histidine (IEA) | GO:0050743

Domains

  • ( PF00488 ) MutS domain V
  • ( PF03904 ) Domain of unknown function (DUF334)
  • ( PF05188 ) MutS domain II
  • ( PF05190 ) MutS family domain IV
  • ( PF05192 ) MutS domain III
  • ( PF08011 ) Protein of unknown function (DUF1703)
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( TIGR01069 ) MutS2 family protein
  • ( TIGR01070 ) DNA mismatch repair protein MutS

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08853.1 9.997093137033517e-262
Description: MutS domain III family protein (815 aa)
Oxytricha Contig22029.0.g67 9.997093137033517e-262
Description: MutS domain V
SGD YOL090W 8.995855300591991e-150
Description: MSH2 Protein that forms heterodimers with Msh3p and Msh6p that bind to DNA mismatches to initiate the mismatch repair process; contains a Walker ATP-binding motif required for repair activity; Msh2p-Msh6p binds to and hydrolyzes ATP
DictyBase DDB_G0275809 7.000020090806431e-140
Description: msh2 on chromosome: 2 position 5513128 to 5516287
WormBase WBGene00003418 1.0000732791548452e-89
Description: locus:msh-2 status:Confirmed UniProt:Q9TXR4 protein_id:CCD68358.1
Stentor Coeruleus SteCoe_34271 1.368539471173853e-44
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295920(coding)
ATGGAAGAGGAAATTGAATTAGTTAATGATAAGAACTTGATGGTTCTTGCTGTTTATTTT
ACTTACCCAAACAATACTCGTTAAGTAAATGCTGCTATTTTAGACAGTGATTAAAGAAAA
TTCTAAGTTACAGAATTCTAAGACACAGAATATTACTCAAATTTTGAGTCCCTCATTCTC
TAGACCAACCCTTAAAATTAGCATACCCAATTTTTGTTGTTAATCCAGTATCCAGATTTG
ACAACAGAAAAAGAAAAAGTCAATGATATTGTTTAACAATGCGACATTAATGTGAAAGAA
AAGGATAAGAAAAGTTTTTTAGAAAAGGGTTATGAAGATGACCTTAATAAATTATTAAAA
AAACCTTTAGCCTAATATATTTAAGAAAGTTAACTTACTCATGCTTTGAGTAGTTTGGCT
TGTATTGTAGGTGATTTATAACTGTCTAAAGAACCTACTAATTAAAATTAATTCACTGTT
GAGACATTGATCTTGAATAATTTTATGAAATTGGATCTCGCTGCTATTAATGCCCTTTTA
ATTTTCCCAAAAGAAAAAGATATCTAGAGAAGAAACTTAATGGGTGGTCAAGAAAATAAT
TTTAGTACATTAGTTGACTTATTAGACAAGTGCAAAACTCAAATTGGCAGTAGAACCTTA
AAGCGCTGGATAAAGCAACCTCTTAAAAATGAGGCTGAAATCAATAGAAGACTTGATATT
GTTGAATATTTTGTCAACAATTAAGATTTGAGAAACTACATTCAAAATGAATTTTTAAGA
AAAATAGCTGACTTAGATAAGCTATATGCTAAATTCTATAAAGTCGCTAGTAAGAAAAAG
CATAACGCTAGTTTAGCTGATTGTATCAAAGTCTATCAACTTGTTACTAATCTAAGTACT
TTAGCACAATATATTGAAAATAACCACTCAGCTGATGAATTAGCATAGAGGGAATTTTTA
ATACCTTTAGGGGAAATACTTGAAAATTTTGAAAAGCTTTCTAGTATGATTGATTAATCA
ATAGATATGGAAAAGGCGAGACGTGATAATGAATACTAAGTTAGTTCTAAATTCTCTCCA
ACTTTAGCAGAACTTGCAAAACAAATGAAATAAATCATGAAGTAAATTGAATCATTAAGA
AATGAATATGCATAAGAATTAGGAGTTGAGCCTAAATTAGTGGAATCTACTACTCACACT
TATTTGTTTGAAAGTAAAAAGAAAGAGACAGATGAAGCCTTCCGTCGTCTCCATAGTCGT
AAGTATAAATCTATTTCAGTTAAGAAAGGCTGTATTTCCTTTACAACTGATGAATTATAA
GCTTGTGTAGCTGAGTATAACAGCTTAAAAGATAACTATTAAGAAGAGTAGAAGTCTGTA
GTTTAGAAAATATTAGACGTCGTTTCTACATACTACCCTGCTATGGAACGTGCAAGTTTC
GTTATTTCTGAATTGGATGTTCTTGCTAACTTTGCTTCTTTAGTTAACTCAGCCACTCGT
CCATATGTCAAACCCAATATTCATGCATCAAATAAGCAAATTAACTTAGTAGAATCTCGT
CATCCCTGCTTAGAAGTAATGGACAATAATTGTGTAGCAAATGACTGCTTTATGGATAAT
GACAAGTCTCGTTTCCATATCATTACTGGGCCAAATATGGGTGGTAAAAGTACTTTTATT
AGATAAGTTGCCATATGCGTTCTATTAGCTCATATTGGTTGCTTTATACCCTGCAAGAGT
GGTGAAATGCCTATCATTGATGCAATCATTACAAGAGTAGGTGCAAGTGATATGCAACTT
CGTGGTATTAGTACTTTCATGAGTGAAATGTTAGAAGCTTCTAACATGTTAATGACAGCA
ACTGAAAATTCTTTAATTATAATCGATGAACTTGGTCGTGGTACTTCTACAAGTGAAGGA
TTTGGTATCGCATGGGCTATTTCAGAACATATTGCTAATAAAATCAAATGTTATTGCTTA
TTTGCAACTCATTTCCATGAAATGACCAAAATGGAACAAGAAGTTAAAGGAGTAATTAAC
TATTATGTAAGCTGTGTAACAATAGACAATAAATTGACTATGCAATATAAATTAAAGAGA
GGTTTTGCTGAGCGTAGTTATGGTTTGTTTGTTGCAGAAACTTTAGATTTCCCTAGAGAA
ATTCTTGAGCATGCCTCAAATAAGCTTTTAGAACTGGAAAGTTATTCAAAGGGAATTTCT
GAAAACCAGAGCTCGGATTAAAATTTTGAGAATTTCAATAAAAATAGCTAAACAGACGAC
ATATTTTTACTTAGTAAGAACTCAACAATTGCTCAAAAAGAAGCTGTTGTTGATCTTGCT
TCTTCCTATAATGAAAAAATAAGAAATGCTGCTTCTAAAGAATAAAAGAAGTAACTACTT
AATGAATTAAAATAAAAAATTATTTCTGCTTTAAAATCTTGA


>TTHERM_00295920(gene)
ATGGAAGAGGAAATTGAATTAGTTAATGATAAGAACTTGATGGTTCTTGCTGTTTATTTT
ACTTACCCAAACAATACTCGTTAAGTAAATGCTGCTATTTTAGACAGTGATTAAAGAAAA
TTCTAAGTTACAGAATTCTAAGACACAGAATATTACTCAAATTTTGAGTCCCTCATTCTC
TAGACCAACCCTTAAAATTAGCATACCCAATTTTTGTTGTTAATCCAGTATCCAGATTTG
ACAACAGAAAAAGAAAAAGTCAATGATATTGTTTAACAATGCGACATTAATGTGAAAGAA
AAGTAATTTTTATTGAATAAAATTGAAATTTCATTTTAAAAATCTTATTTAAATGTAAAA
ATTATAGGGATAAGAAAAGTTTTTTAGAAAAGGGTTATGAAGATGACCTTAATAAATTAT
TAAAAAAACCTTTAGCCTAATATATTTAAGAAAGTTAACTTACTCATGCTTTGAGTAGTT
TGGCTTGTATTGTAGGTGATTTATAACTGTCTAAAGAACCTACTAATTAAAATTAATTCA
CTGTTGAGACATTGATCTTGAATAATTTTATGAAATTGGATCTCGCTGCTATTAATGCCC
TTTTAATTTTCCCAAAAGAAAAAGATATCTAGAGAAGAAACTTAATGGGTGGTCAAGAAA
ATAATTTTAGTACATTAGTTGACTTATTAGACAAGTGCAAAACTCAAATTGGCAGTAGAA
CCTTAAAGCGCTGGATAAAGCAACCTCTTAAAAATGAGGCTGAAATCAATAGAAGACTTG
ATATTGTTGAATATTTTGTCAACAATTAAGATTTGAGAAACTACATTCAAAATGAATTTT
TAAGAAAAATAGCTGACTTAGATAAGCTATATGCTAAATTCTATAAAGTCGCTAGTAAGA
AAAAGCATAACGCTAGTTTAGCTGATTGTATCAAAGTCTATCAACTTGTTACTAATCTAA
GTACTTTAGCACAATATATTGAAAATAACCACTCGTAAATTCTATTTGCATGTTATTAAT
AATATTTTATTGATTAAATTATAAAAAAAAAGAGCTGATGAATTAGCATAGAGGGAATTT
TTAATACCTTTAGGGGAAATACTTGAAAATTTTGAAAAGCTTTCTAGTATGATTGATTAA
TCAATAGATATGGAAAAGGCGAGACGTGATAATGAATACTAAGTTAGTTCTAAATTCTCT
CCAACTTTAGCAGAACTTGCAAAACAAATGAAATAAATCATGAAGTAAATTGAATCATTA
AGAAATGAATATGCATAAGAATTAGGAGTTGAGCCTAAATTAGTGGAATCTACTACTCAC
ACTTATTTGTTTGAAAGTAAAAAGAAAGAGACAGATGAAGCCTTCCGTCGTCTCCATAGT
CGTAAGTATAAATCTATTTCAGTTAAGAAAGGCTGTATTTCCTTTACAACTGATGAATTA
TAAGCTTGTGTAGCTGAGTATAACAGCTTAAAAGATAACTATTAAGAAGAGTAGAAGTCT
GTAGTTTAGAAAATATTAGACGTCGTTTCTACATACTACCCTGCTATGGAACGTGCAAGT
TTCGTTATTTCTGAATTGGATGTTCTTGCTAACTTTGCTTCTTTAGTTAACTCAGCCACT
CGTCCATATGTCAAACCCAATATTCATGCATCAAATAAGCAAATTAACTTAGTAGAATCT
CGTCATCCCTGCTTAGAAGTAATGGACAATAATTGTGTAGCAAATGACTGCTTTATGGAT
AATGACAAGTCTCGTTTCCATATCATTACTGGGCCAAATATGGGTGGTAAAAGTACTTTT
ATTAGATAAGTTGCCATATGCGTTCTATTAGCTCATATTGGTTGCTTTATACCCTGCAAG
AGTGGTGAAATGCCTATCATTGATGCAATCATTACAAGAGTAGGTGCAAGTGATATGCAA
CTTCGTGGTATTAGTACTTTCATGAGTGAAATGTTAGAAGCTTCTAACATGTTAATGACA
GCAACTGAAAATTCTTTAATTATAATCGATGAACTTGGTCGTGGTACTTCTACAAGTGAA
GGATTTGGTATCGCATGGGCTATTTCAGGTAATTTAAAACCTTATTATAAATTAATTTAT
TATAATTATAATTATTTAATTACTAGAACATATTGCTAATAAAATCAAATGTTATTGCTT
ATTTGCAACTCATTTCCATGAAATGACCAAAATGGAACAAGAAGTTAAAGGAGTAATTAA
CTATTATGTAAGCTGTGTAACAATAGACAATAAATTGACTATGCAATATAAATTAAAGAG
AGGTTTTGCTGAGCGTAGTTATGGTTTGTTTGTTGCAGAAACTTTAGATTTCCCTAGAGA
AATTCTTGAGCATGCCTCAAATAAGCTTTTAGAACTGGAAAGTTATTCAAAGGGAATTTC
TGAAAACCAGAGCTCGGATTAAAATTTTGAGAATTTCAATAAAAATAGCTAAACAGACGA
CATATTTTTACTTAGTAAGAACTCAACAATTGCTCAAAAAGAAGCTGTTGTTGATCTTGC
TTCTTCCTATAATGAAAAAATAAGAAATGCTGCTTCTAAAGAATAAAAGAAGTAACTACT
TAATGAATTAAAATAAAAAATTATTTCTGCTTTAAAATCTTGA


>TTHERM_00295920(protein)
MEEEIELVNDKNLMVLAVYFTYPNNTRQVNAAILDSDQRKFQVTEFQDTEYYSNFESLIL
QTNPQNQHTQFLLLIQYPDLTTEKEKVNDIVQQCDINVKEKDKKSFLEKGYEDDLNKLLK
KPLAQYIQESQLTHALSSLACIVGDLQLSKEPTNQNQFTVETLILNNFMKLDLAAINALL
IFPKEKDIQRRNLMGGQENNFSTLVDLLDKCKTQIGSRTLKRWIKQPLKNEAEINRRLDI
VEYFVNNQDLRNYIQNEFLRKIADLDKLYAKFYKVASKKKHNASLADCIKVYQLVTNLST
LAQYIENNHSADELAQREFLIPLGEILENFEKLSSMIDQSIDMEKARRDNEYQVSSKFSP
TLAELAKQMKQIMKQIESLRNEYAQELGVEPKLVESTTHTYLFESKKKETDEAFRRLHSR
KYKSISVKKGCISFTTDELQACVAEYNSLKDNYQEEQKSVVQKILDVVSTYYPAMERASF
VISELDVLANFASLVNSATRPYVKPNIHASNKQINLVESRHPCLEVMDNNCVANDCFMDN
DKSRFHIITGPNMGGKSTFIRQVAICVLLAHIGCFIPCKSGEMPIIDAIITRVGASDMQL
RGISTFMSEMLEASNMLMTATENSLIIIDELGRGTSTSEGFGIAWAISEHIANKIKCYCL
FATHFHEMTKMEQEVKGVINYYVSCVTIDNKLTMQYKLKRGFAERSYGLFVAETLDFPRE
ILEHASNKLLELESYSKGISENQSSDQNFENFNKNSQTDDIFLLSKNSTIAQKEAVVDLA
SSYNEKIRNAASKEQKKQLLNELKQKIISALKS