Identifiers and Description

Gene Model Identifier

TTHERM_00298510

Standard Name

RAB57 (RAB GTPase 57)

Aliases

PreTt19253 | 28.m00212 | 3691.m00031

Description

RAB57 Ras family small GTPase; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07579.1 3.0006488705143073e-92
Description: small GTP-binding protein domain-containing protein (172 aa)
Oxytricha Contig80.0.1.g111 9.996273942859018e-26
Description: Ras family
WormBase WBGene00004267 2.99851380290819e-19
Description: locus:rab-3 Ras-related protein Rab-3 status:Confirmed UniProt:Q94986 protein_id:CCD65021.1
DictyBase DDB_G0272138 1.999598840915195e-17
Description: rab2B on chromosome: 2 position 1483407 to 1484594
SGD YFL038C 0.000000000000006000101554955223
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
Stentor Coeruleus SteCoe_28198 0.00000000027894680928689246
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00298510(coding)
ATGTATACAACTAATGGTTAAACCTTCTTGAAAGATTATAATATGACTTAAGCTGCAGAA
GTTTCTTCCAAAATCATTCCTTTTCCTGAAAAAGATAAAGATGTAGAGCTTTTCTTTTTT
GATATTAGTGGATAAGACTGCTACTAATCGATCACATCTGAGTTACTAGGACAAGCAGAT
CTTTTAGTTTTAGTTTATGATTGCACAAGCTAAGAAAGCTACAATAAACTTTAGACATGG
TATGATAAAGTCAAACAAAAGAATTCTAAATCTCTTTAAGGTGTTTTAATTTCAACTAAA
AACGATTTAAGTGGTGCTAGATAAGTAGATCCTCAACAAGCAAGAGACTTAGCAAAGAAA
CTTAATTTATAATTTTTTGAAGTTTCTTCAGCACGTAATACCAACATAGATCTACCTTTC
TAAAACTTAGCAGAAAGACTTGTATGA


>TTHERM_00298510(gene)
ATGTATACAACTAATGGTTAAACCTTCTTGAAAGATTATAATATGGTACATAAATATTTG
CATTAAAATGATAAAGTTTACTTATATCAAATTAACTTAAATTATTTATTAAACAGACTT
AAGCTGCAGAAGTTTCTTCCAAAATCATTCCTTTTCCTGAAAAAGATAAAGATGTAGAGC
TTTTCTTTTTTGATATTAGTGGATAAGACTGCTACTAATCGATCACATCTGAGTTAGTAA
AAATATTAAAAAGTTAGCAAAACAATATTTTAAAAACTCTTCTTTTTAATAGCTAGGACA
AGCAGATCTTTTAGTTTTAGTTTATGATTGCACAAGCTAAGAAAGCTACAATAAACTTTA
GACATGGTATGATAAAGTCAAACAAAAGAATTCTAAATCTCTTTAAGGTGATTAAATAAA
TGAATATATTTTAGTTAGGTTATTGACAGTTATTAATATATAAAAGGTGTTTTAATTTCA
ACTAAAAACGATTTAAGTGGTGCTAGATAAGTAGATCCTCAACAAGCAAGAGACTTAGCA
AAGAAACTTAATTTATAATTTTTTGAAGTTTCTTCAGCACGTAATACCAACATAGATCTA
CCTTTCTAAAACTTAGCAGAAAGACTTGTATGA


>TTHERM_00298510(protein)
MYTTNGQTFLKDYNMTQAAEVSSKIIPFPEKDKDVELFFFDISGQDCYQSITSELLGQAD
LLVLVYDCTSQESYNKLQTWYDKVKQKNSKSLQGVLISTKNDLSGARQVDPQQARDLAKK
LNLQFFEVSSARNTNIDLPFQNLAERLV