Identifiers and Description

Gene Model Identifier

TTHERM_00301790

Standard Name

RRM9 (RNA recognition motif-containing protein 9)

Aliases

PreTt19375 | 28.m00334 | 3691.m00151

Description

RRM9 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07709.1 9.997093137033517e-262
Description: hypothetical protein (419 aa)
DictyBase DDB_G0279639 0.000000019990673443141236
Description: DDB_G0279639 on chromosome: 3 position 2350407 to 2353794
SGD YHR015W 0.000030009396760408108
Description: MIP6 Putative RNA-binding protein, interacts with Mex67p, which is a component of the nuclear pore involved in nuclear mRNA export
Oxytricha Contig4061.0.g90 0.00006000996057121373
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00301790(coding)
ATGATTCAAGATATTCCTCAAGCTTAAGATTAAACATTAGAAAATGTATTTATTTCAGGA
ATAGATCCCTCTGTTACAGAAAAAGAATTATAAGATTTAATTAGGTTTACAGTAGGATCA
CAACTACAAATTTCGATTAGCAAAATTATAGCTGCAGGATAGGAAAGACTTCTCGGAGAA
GTAAAATGCAAGCTTGAAGAAGCAACTATTCTTCACCACAAGCTCAATAATACTCATCTC
AAGAATTGCTTTCTTAAATTAGTCCCTTAATCTTGCATGAAAAGCATTATTATCCAAAAT
CTTCCTAAAGTATTCAATGAAAAGGACTTATTTAAGATTTTAAACGAACTTACTCCAAAT
TCTTTGAAAAGAATTATTATTGCAGATAATCCAGAAGTTGTTGGAGAAACAGTGGGAGTA
GCTGTAGCAATATATCAAAATTATGAATTGGCATTGAAAGCTATTAAGGCACTCAAGCAA
CAAGGCGAATTATTTAAGTGTAAGATAGATGTATGCTGGAAAGAACCTGATTTCGATATA
ATCAAGGAGCTTTCGATGCAAACAAAAGTTCTTTGTGTTAAGAATATATCTTCATGCACA
GAAACAAGCAAAATAAAAGATGCTTTTTCAGTTTATGGAACAGTAGTTAGAATTTAGAGA
TACTCAACACATGCTTTTGTTGAATTTTTAAATATAGAAAGCGCTAAAAATGCTTTAGCT
GCTTTAAGTGATAAGAGGTTTGAAGGTGGAATAATATGGCATATCTACCCAGCTAAGAAG
TTAGATATTGAAAGACAATACGAAGATGTTGATAAAAACAGAACATTCTCAAAAAATTTT
TTACCTGAAACAGACCAATAAATTTTAAGAAAGTTTTTATTTGACGGATAACTCCCTGCC
CTAGATAGCAAAGTAAGCTAAACTGCATCAAATTTGCTTTAGCACATTAAAAGTATGCAA
TAAAATATGATAAACTCGCTTTAAATCAAGGCAGACACATATAGATAGCTTTAAAATAGC
ATGAATCCTCAGTAAAACAATAACAATAATAATAACAATAATTTGAATAACTTGCCAATT
TAGTAATAAATCCCTGTTTAAAACATGATGAATATGTAAGGGGCAATGAATATGAACTAA
TTCTAAATAAATCCAATCTAAGCAAGCAGTAATAATAATATTAATATGAATATGGGAATG
TAATAATAGTGGGGTATGAACTGA


>TTHERM_00301790(gene)
ATGATTCAAGATATTCCTCAAGCTTAAGATTAAACATTAGAAAATGTATTTATTTCAGGA
ATAGATCCCTCTGTTACAGAAAAAGAATTATAAGGTGGATATTTAATCATAAAAATAAAG
TGAAGCCATAAACATTTTGCTTTTGAATATTTATACATTAAACTTTATTGCTACTTTATG
AAATATTTTTTACATGAGCAACGATAACTAAAAAACCTATTTATTACTTATCCCACATAT
TGCACATTTTAGGAAAATATATATCTTAAAGTTTTTGTGCAGAAGGTTGTGTTATTTTTT
GTTAATATTACCTTATCTCGTAATTTTTTAAAGAAATCAAATTTTAAGTAGCAACTGTTT
TTGTAAATATCAATGCAAATGTTTTTCAGTCATGGCTAATGAATAATATTTAACGAAATA
AATTGAAAATAAAATAGATTTAATTAGGTTTACAGTAGGATCACAACTACAAATTTCGAT
TAGCAAAATTATAGCTGCAGGATAGGAAAGACTTCTCGGAGAAGTAAAATGCAAGCTTGA
AGAAGCAACTATTCTTCACCACAAGCTCAATAATACTCATCTCAAGAATTGCTTTCTTAA
ATTAGTCCCTTAATCTTGCATGAAAAGCATTATTATCCAAAATCTTCCTAAAGTATTCAA
TGAAAAGGACTTATTTAAGATTTTAAACGAACTTACTCCAAATTCTTTGAAAAGAATTAT
TATTGCAGATAATCCAGAAGTTGTTGGGTATGGAATTTTTTAAGCACAATTTATTAACCT
TAATATTAACTTGGTATTATTTTAATAATATGTAAAGAGAAACAGTGGGAGTAGCTGTAG
CAATATATCAAAATTATGAATTGGCATTGAAAGCTATTAAGGCACTCAAGCAACAAGGCG
AATTATTTAAGTGTAAGATAGATGTATGCTGGAAAGAACCTGATTTCGATATAATCAAGG
AGCTTTCGATGCAAACAAAAGTTCTTTGTGTTAAGAATATATCTTCATGCACAGAAACAA
GCAAAATAAAAGATGCTTTTTCAGTTTATGGAACAGTAGTTAGAATTTAGAGATACTCAA
CACATGCTTTTGTTGAATTTTTAAATATAGAAAGCGCTAAAAATGCTTTAGCTGCTTTAA
GTGATAAGAGGTTTGAAGGTGGAATAATATGGCATATCTACCCAGCTAAGAAGTTAGATA
TTGAAAGGTAAAATAAATATATTTTCATTTATTTATTTAAAAATTTACTTTTCTACTTTA
GAGAAATATGAATTTAAATTAATTAAAATATATTTTTTAATAAAGACAATACGAAGATGT
TGATAAAAACAGAACATTCTCAAAAAATTTTTTACCTGAAACAGACCAATAAATTTTAAG
AAAGTTTTTATTTGACGGATAACTCCCTGCCCTAGATAGCAAAGTAAGCTAAACTGCATC
AAATTTGCTTTAGCACATTAAAAGTATGCAATAAAATATGATAAACTCGCTTTAAATCAA
GGCAGACACATATAGATAGCTTTAAAATAGCATGAATCCTCAGTAAAACAATAACAATAA
TAATAACAATAATTTGAATAACTTGCCAATTTAGTAATAAATCCCTGTTTAAAACATGAT
GAATATGTAAGGGGCAATGAATATGAACTAATTCTAAATAAATCCAATCTAAGCAAGCAG
TAATAATAATATTAATATGAATATGGGAATGTAATAATAGTGGGGTATGAACTGA


>TTHERM_00301790(protein)
MIQDIPQAQDQTLENVFISGIDPSVTEKELQDLIRFTVGSQLQISISKIIAAGQERLLGE
VKCKLEEATILHHKLNNTHLKNCFLKLVPQSCMKSIIIQNLPKVFNEKDLFKILNELTPN
SLKRIIIADNPEVVGETVGVAVAIYQNYELALKAIKALKQQGELFKCKIDVCWKEPDFDI
IKELSMQTKVLCVKNISSCTETSKIKDAFSVYGTVVRIQRYSTHAFVEFLNIESAKNALA
ALSDKRFEGGIIWHIYPAKKLDIERQYEDVDKNRTFSKNFLPETDQQILRKFLFDGQLPA
LDSKVSQTASNLLQHIKSMQQNMINSLQIKADTYRQLQNSMNPQQNNNNNNNNNLNNLPI
QQQIPVQNMMNMQGAMNMNQFQINPIQASSNNNINMNMGMQQQWGMN