Identifiers and Description

Gene Model Identifier

TTHERM_00307700

Standard Name

AIP3 (Asf1-Interacting Protein 3)

Aliases

PreTt21273 | 29.m00234 | 3696.m00055 | BRCT1

Description

AIP3 BRCA1 carboxy-terminus (BRCT) domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF00533 ) BRCA1 C Terminus (BRCT) domain
  • ( PF02891 ) MIZ/SP-RING zinc finger
  • ( PF04564 ) U-box domain
  • ( PF06827 ) Zinc finger found in FPG
  • ( TIGR00599 ) DNA repair protein rad18

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11635.1 9.997093137033517e-262
Description: hypothetical protein (367 aa)
DictyBase DDB_G0293300 4.999245259173412e-21
Description: DDB_G0293300 on chromosome: 6 position 2733345 to 2736998
WormBase WBGene00011365 0.00000019998969434520019
Description: Uncharacterized RING finger protein T02C1.1 status:Partially_confirmed UniProt:Q03605 protein_id:CAA79563.1
Oxytricha Contig4056.0.0.g86 0.00000030014504373857585
Description: Zinc finger, C3HC4 type (RING finger)
SGD YCR066W 0.0000029996948234116693
Description: RAD18 E3 ubiqutin ligase, forms heterodimer with Rad6p to monoubiquitinate PCNA-K164; heterodimer binds single-stranded DNA and has single-stranded DNA dependent ATPase activity; required for postreplication repair

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00307700(coding)
ATGGAACTATCTTAAAACTATTAGAATTATCATTATATACTAGAGCCTGATGATTTTTTA
GCTTTAAAAAACGAAACTAGATGCGCAATATGTTTAGATATTTTTGAGGATCCTGTAACA
ACTTTTTGTTAACATACTTATTGTAAAAAATGCTTAGAAAATCATATTAGAAGTAATGGA
GCTAAATAAGCATTTTGTCCACTTTGCAAGATGCCCGTTGGTAAGAGAAACTACATTCCT
GATAAAAAGGCTCAAGTTTTAGCATCAATAATCTTAAATATAAAGCCGATTAAGAAAATA
CAAATAACTGAAACACCTAAAAAAGACTTACTTTCAACACGCAAAAGAAAAGCTAGCGAG
TTACATCAACCTTTAAAATCTTATGAAATATAATCCAATTAAATTCAAAGTATATAAAAA
AATGAGAATAGTACTATTAGTAGCAGTAATAACAACTCAAAACCAAAAACAAGAAAGAGG
AATGATAAAATAAATATTTTAGTTTCAAACATGCCAGAAGAATTTTAACATGAAGTAGAT
AAATTTTGCAAGCTATATAAGGCTAAGCAATTCAAAGATTATCATGAATAACTCACTCAT
TTAGTTGTATTTCCAATAGATTAAAAAGATGATAAAATAATTGCCAAAAGAACTTTAAAA
TACTTAAGCGCTTTAGTGGAGGGAATATGGATTGTAGGATTTAATTGGATAATACACTCT
AATGGGTACAACGAATTGAAAGATGAAGAAGAATTTGAAGTTTATGGTGATCCTTATGGG
ATTAATACTCCTAGAGAATCTCGTCTTAGAAACGGATTGACAGATCTACTTGAAAACTTA
AGATTTTATATAAGTGAAAAGCAAACAAAAAAAGATTAATAAATAACTAAGAAAGAAATG
GTTTAGCTGATAAAATTAGCAGGAGGAGTCGTAATAGATAATAATAGAGATGAACCAGAA
GAATATTTCCATGTAGTAATAACATCAGGAGCGTAAAATATTGATAAAAATAGTTTAAAA
TCTCTCAAATCATCAAGTAACGATGGCTAAATAATAGTTTCTCATAAATGGCTGTTAGAT
TCAATTAGCAAAGGCTAGCTTTTGAATTACAAAAATTATACCTGA


>TTHERM_00307700(gene)
ATGGAACTATCTTAAAACTATTAGAATTATCATTATATACTAGAGCCTGATGATTTTTTA
GCTTTAAAAAACGAAACTAGATGCGCAATATGGTAATGATAGCTTAATTCACTAATAATT
CTTAAAATTACATTTTAATACTTAAGTTTAGATATTTTTGAGGATCCTGTAACAACTTTT
TGTTAACATACTTATTGTAAAAAATGCTTAGAAAATCATATTAGAAGTAATGGAGCTAAA
TAAGCATTTTGTCCACTTTGCAAGATGCCCGTTGGTAAGAGAAACTACATTCCTGATAAA
AAGGCTCAAGTTTTAGCATCAATAATCTTAAATATAAAGCCGATTAAGAAAATACAAATA
ACTGAAACACCTAAAAAAGACTTACTTTCAACACGCAAAAGAAAAGCTAGCGAGTTACAT
CAACCTTTAAAATGTGAACATGTTTGTTTAATTAATTGATTGATATTTATTTGTTTTAGA
TAAAATGAATTGAGTAAAGTTAAATTCTAAATAATTATATTGAAATAAATTAGCTTATGA
AATATAATCCAATTAAATTCAAAGTATATAAAAAAATGAGAATAGTACTATTAGTAGCAG
TAATAACAACTCAAAACCAAAAGTAAAATTATTAATCAGTTAAGAAAAATAAATAGATTA
ATAAATAAATATTCGTATTAGACAAGAAAGAGGAATGATAAAATAAATATTTTAGTTTCA
AACATGCCAGAAGAATTTTAAGTAAATTTAAAATATTATTTTTGAGCTTATAGATAAATG
TAAATTTTCATGAAAAAGCATGAAGTAGATAAATTTTGCAAGCTATATAAGGCTAAGCAA
TTCAAAGATTATCATGAATAACTCACTCATTTAGTTGTATTTCCAATAGATTAAAAAGAT
GATAAAATAATTGCCAAAAGAACTTTAAAATACTTAAGCGCTTTAGTGGAGGGAATATGG
ATTGTAGGATTTAATTGTAATTTTTAATCTTTCTTATTCTTTTAAATTAAATTCTAAAAA
AAAAAATAGGGATAATACACTCTAATGGGTACAACGAATTGAAAGATGAAGAAGAATTTG
AAGTTTATGGTGATCCTTATGGGATTAATACTCCTAGAGAATCTCGTCTTAGAGTAAACA
TAAAAAAACTAATAAATAAGTTTTTTATTTTTGTATAATTATACAAAGAACGGATTGACA
GATCTACTTGAAAACTTAAGATTTTATATAAGTGAAAAGCAAACAAAAAAAGATTAATAA
ATAACTAAGAAAGAAATGGTTTAGCTGATAAAATTAGCAGGAGGAGTCGTAATAGATAAT
AATAGAGATGAACCAGAAGAATATTTCCATGTAGTAATAACATCAGGAGCGTAAAATATT
GATAAAAATAGTTTAAAATCTCTCAAATCATCAAGTAACGATGGCTAAATAATAGTTTCT
CATAAATGGCTGTTAGATTCAATTAGCAAAGGCTAGCTTTTGAATTACAAAAATTATACC
TGA


>TTHERM_00307700(protein)
MELSQNYQNYHYILEPDDFLALKNETRCAICLDIFEDPVTTFCQHTYCKKCLENHIRSNG
AKQAFCPLCKMPVGKRNYIPDKKAQVLASIILNIKPIKKIQITETPKKDLLSTRKRKASE
LHQPLKSYEIQSNQIQSIQKNENSTISSSNNNSKPKTRKRNDKINILVSNMPEEFQHEVD
KFCKLYKAKQFKDYHEQLTHLVVFPIDQKDDKIIAKRTLKYLSALVEGIWIVGFNWIIHS
NGYNELKDEEEFEVYGDPYGINTPRESRLRNGLTDLLENLRFYISEKQTKKDQQITKKEM
VQLIKLAGGVVIDNNRDEPEEYFHVVITSGAQNIDKNSLKSLKSSSNDGQIIVSHKWLLD
SISKGQLLNYKNYT