Identifiers and Description

Gene Model Identifier

TTHERM_00312120

Standard Name

DTS1 (Dihydrofolate reductase-Thymidylate Synthase 1)

Aliases

PreTt03400 | 30.m00209 | 3810.m01825

Description

DTS1 dihydrofolate reductase-thymidylate synthase; Bifunctional dihydrofolate reductase-thymidylate synthase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03227.1 9.997093137033517e-262
Description: bifunctional dihydrofolate reductase-thymidylate synthase (486 aa)
Oxytricha Contig20294.0.g9 6.000727524697947e-169
Description: Thymidylate synthase
WormBase WBGene00022455 9.998919090800975e-129
Description: Thymidylate synthase status:Confirmed UniProt:Q9N588 protein_id:CCD66193.1
SGD YOR074C 2.9990837046884738e-127
Description: CDC21 Thymidylate synthase, required for de novo biosynthesis of pyrimidine deoxyribonucleotides; expression is induced at G1/S
Stentor Coeruleus SteCoe_17804 3.665820411179563e-77
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00312120(coding)
ATGAAAACAAGACATTTTGATATAGTTTTAGCTTAGACTTTAAAAAAATAGGGTATAGGT
TATAAGAACAGTTTACCATGGAGACTACCTAATGAGCTTAAAAACTTTAAAAAAATAACT
ACAGAAACTAAGAACAAAGGCCTATAAAACGCTGTTATCATGGGTAAAAATACTTGGGAA
GCACTACCTAAAAAGCAATAACCATTGAAAGATCGCTTAAATATTGTTATTTCCACTACT
ATGCAAGAGGGGTAAATTGCAGATCATTCCTACGCCTGTAAAAGCTTAGATTCTGCTTTA
AACTTTTTAGAATAGTAAAATTAAATATAAGATGCCCTTGTAATTGGAGGAGCTAAACTT
TGCCAATAAGCATTAAGCGATCAGAGACTTAGATAGATTCATCTAACAAGAGTAGGTGTC
GAAGTTGAGTGCGATGTTTTTATGCAAAAGGACTACTTAAAAAACTTTGATATGATTGAG
GTGTCTGAAACTTAAAGCGAAAATAATTTAAATTATGATTTTACTAGGTATTTTAATAAG
AATTATAAAGGATAAGTTGACCCTTCTCTCTTTAAGAAAATGTACAAGCCTCATCAAGAA
TATTAATACTTAGAACTTATCGATGAAATTATAAAGAATGGACATGTTAAAACAGACAGA
ACTGGAACTGGTACAATTTCTCAGTTTGGCAAGTTGATGAGATTTGACTTATCAAAGAGT
TTTCCTCTGCTTACTACCAAAAATGTTTTTTGGAGAGGTGTAGTAGAAGAACTTATTTGG
TTTATCAAAGGCAGTACAAACAGCAAAATACTTTCAGAAAAAGGAGTTAAAATATGGGAC
GGTAATGGCAGCAGAGAATTTTTAGATTAATTAGGCTTTAAAAACAGAGAAGAAGGAGAT
TTAGGTCCTGTTTATGGTTTCTAATGGAGACACTTCGGTGCTGAATATAAAGATATGCAT
ACAAATTATAAAGGTAAAGGTGTCGACCAGCTTCAAGATTTAATTAACACAATAAAGAAA
AATCCTGACAGCAGAAGGATGATTATGAATGCCTGGAATGTTAAAGATCTACCATTGATG
GCTTTACCTCCTTGTCATGTCATGAGCTAGTTTTATGTAAATGATAATAAACTAAGCTGT
ATGATGTACTAAAGATCTTGTGATATGGGTTTAGGAATACCATTTAATATAGCCAGTTAT
GCTTTATTGACTCATATGATAGCTTAAGTCACTAATATGTAAGTTGGAGAGTTTATACAT
GTTCTAGGTGATGCTCATGTTTACTCTAATCACGTAGATTAACTAAAAATTTAATTAGAA
AGAGCTCCATACCCCTTCCCTCTTTTAAAAATTAATAACAACAAGTAATATAACTCTATT
GAAGACTTCACTCTTGAAGATTTCGAATTAATTGGATACAACTATCACCCTAAAATATAA
ATGAAAATGGCTGTCTGA


>TTHERM_00312120(gene)
ATGAAAACAAGACATTTTGATATAGTTTTAGCTTAGACTTTAAAAAAATAGGGTATAGGT
TATAAGAACAGTTTACCATGGAGACTACCTAATGAGCTTAAAAACTTTAAAAAAATAACT
ACAGAAACTAAGAACAAAGGCCTATAAAACGCTGTTATCATGGGTAAAAATACTTGGGAA
GCACTACCTAAAAAGCAATAACCATTGAAAGATCGCTTAAATATTGTTATTTCCACTACT
ATGCAAGAGGGGTAAATTGCAGATCATTCCTACGCCTGTAAAAGCTTAGATTCTGCTTTA
AACTTTTTAGAATAGTAAAATTAAATATAAGATGCCCTTGTAATTGGAGGAGCTAAACTT
TGCCAATAAGCATTAAGCGATCAGAGACTTAGATAGATTCATCTAACAAGAGTAGGTCAG
TAGAATTAAATTTATTAAATACTTTCTTTTTATGAACAAAAGAGATAATTAAATAACTTT
TCAAAAATATTTAGGTGTCGAAGTTGAGTGCGATGTTTTTATGCAAAAGGACTACTTAAA
AAACTTTGATATGATTGAGGTGTCTGAAACTTAAAGCGAAAATAATTTAAATTATGATTT
TACTAGGTATTTTAATAAGAATTATAAAGGATAAGTTGACCCTTCTCTCTTTAAGAAAAT
GTACAAGCCTCATCAAGAATATTAATACTTAGAACTTATCGATGAAATTATAAAGAATGG
ACATGTTAAAACAGACAGAACTGGAACTGGTACAATTTCTCAGTTTGGCAAGTTGATGAG
ATTTGACTTATCAAAGAGTTTTCCTCTGCTTACTACCAAAAATGTTTTTTGGAGAGGTGT
AGTAGAAGTAATAAATATATTTATTTATTTATTAATTTATAGTTTGATAGATTTAAAAAT
GAAATTTAGTCTGATTTTTAGTAGAATAAATAAAATAATCTAAATATATAAATTAATAGG
AACTTATTTGGTTTATCAAAGGCAGTACAAACAGCAAAATACTTTCAGAAAAAGGAGTTA
AAATATGGGACGGTAATGGCAGCAGAGAATTTTTAGATTAATTAGGCTTTAAAAACAGAG
AAGAAGGAGATTTAGGTCCTGTTTATGGTTTCTAATGGAGACACTTCGGTGCTGAATATA
AAGATATGCATACAAATTATAAAGGTAAAGGTGTCGACCAGCTTCAAGATTTAATTAACA
CAATAAAGAAAAATCCTGACAGCAGAAGGATGATTATGAATGCCTGGAATGTTAAAGATC
TACCATTGATGGCTTTACCTCCTTGTCATGTCATGAGCTAGTTTTATGTAAATGATAATA
AACTAAGCTGTATGATGTACTAAAGATCTTGTGATATGGGTTTAGGAATACCATTTAATA
TAGCCAGTTATGCTTTATTGACTCATATGATAGCTTAAGTCACTAATATGTAAGTTGGAG
AGTTTATACATGTTCTAGGTGATGCTCATGTTTACTCTAATCACGTAGATTAACTAAAAA
TTTAATTAGAAAGAGCTCCATACCCCTTCCCTCTTTTAAAAATTAATAACAACAAGTAAT
ATAACTCTATTGAAGACTTCACTCTTGAAGATTTCGAATTAATTGGATACAACTATCACC
CTAAAATATAAATGAAAATGGCTGTCTGA


>TTHERM_00312120(protein)
MKTRHFDIVLAQTLKKQGIGYKNSLPWRLPNELKNFKKITTETKNKGLQNAVIMGKNTWE
ALPKKQQPLKDRLNIVISTTMQEGQIADHSYACKSLDSALNFLEQQNQIQDALVIGGAKL
CQQALSDQRLRQIHLTRVGVEVECDVFMQKDYLKNFDMIEVSETQSENNLNYDFTRYFNK
NYKGQVDPSLFKKMYKPHQEYQYLELIDEIIKNGHVKTDRTGTGTISQFGKLMRFDLSKS
FPLLTTKNVFWRGVVEELIWFIKGSTNSKILSEKGVKIWDGNGSREFLDQLGFKNREEGD
LGPVYGFQWRHFGAEYKDMHTNYKGKGVDQLQDLINTIKKNPDSRRMIMNAWNVKDLPLM
ALPPCHVMSQFYVNDNKLSCMMYQRSCDMGLGIPFNIASYALLTHMIAQVTNMQVGEFIH
VLGDAHVYSNHVDQLKIQLERAPYPFPLLKINNNKQYNSIEDFTLEDFELIGYNYHPKIQ
MKMAV