Identifiers and Description

Gene Model Identifier

TTHERM_00312230

Standard Name

ELP2 (ELongation Protein 2)

Aliases

PreTt03411 | 30.m00220 | 3810.m01836

Description

ELP2 elongator complex protein; RNA polymerase II elongator complex subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03238.1 9.997093137033517e-262
Description: hypothetical protein (847 aa)
Oxytricha Contig19993.0.g37 8.001903776189462e-102
Description: WD domain, G-beta repeat
DictyBase DDB_G0275651 2.998893725394183e-91
Description: elp2 on chromosome: 2 position 5847867 to 5850695
SGD YGR200C 3.0005221502158484e-68
Description: ELP2 Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; target of Kluyveromyces lactis zymocin
WormBase WBGene00013738 5.9995872346509964e-61
Description: locus:elpc-2 status:Partially_confirmed UniProt:Q9NEW7 protein_id:CAC35846.4
Stentor Coeruleus SteCoe_11397 2.4426007377405277e-36
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00312230(coding)
ATGAGTCAATTAGAATTAAGCTGCGTTTAAGGAGGTGTTAACCCCCTTTATAAATGTTTT
GCCTTAGGCAAAGCTGTTAAGGAAGCTTGCTTTTATGCTTGCTCCAATAGCATTATTGTG
AACAATATCAATAAGGTTACTAATTATTTTACTTTAAGTGGACATTCAGATCGCGTTAAC
TTTGTAAAAACTATAAATAATTTTTCTGAGCGTTAGCTTATTGTTTCAGGAAGCAGTGAT
TCCAATTTAATAATTTGGGAAGGTAAACTTTCTAACCTATTTATCAAGGAAAATTGGTCT
ATTAAGCATAAATTTAATCTCAATCACTCTGTTTCATTTGCCACTGTTTTAGAATACTCT
CCTAATCTTGCATATGTCGTAGCTGGTAATATTATGGGTGATGTCTATATTATAAAGATA
AGCGATGAATCTAATCAAAGTTTAATTATGGATAGCATCACATTTGGACATCATTTTACA
TAAGAATGCACTGCACTTATCCGCCACAATCCTAATAAAGATGAATTTTTGATAGCTTTA
GGAGGTTTAGACTTCACTGTTCATATCTATCACACTGATTTAAAGAAATATACAGCTCCA
GTAGATGGTAAAAATACTATGGAAAGAGGTACTTTGTTTGAATACAAAGTTAGTCTTAAA
GGACATGAAAATGCAATTACTGATTTGTAGGTCTTAAAACAAAAAAAAGACACTCATGAA
GAATGGATTATTGCCAGCTCTTCTAAAGATACTTATGTTCGTTTATGGAGATTTAGTGAG
CTCTTAGAAGATGAGACTATTAAGTAAATTTCTGAATTCTAAAATAAGCAAACTTAAAGA
TTCGTTTTAGGCGATAAGAAGTATTTTATCACTTTAGAAAGTGTTTTGAGCGGACACGGT
GAAGCAGTAGTCTGTCTTGACTGGGGTTTGTACAAAGGAGAAACTGCACTTATCTCTGCA
TCATTTGATTTTAACATTATATTATGGACCAAGGATAAAGACACAGATATTTGGTTAACC
TCATACAGATTAGGTTAGGTAACAGGAAGCAAGTATGCCTTTTTCCAAGCTACCTTTAAT
GCTGATTACACATAGATTTTTTCTTACACATACACAGGTTCATTTTACTTATGGGAATAC
AATTAAGAAAAGGGAATTTGGGATTCTAAACCAACTGTTAGTGGCCACTTCAATTAGGTA
TTTGATTTGGATTGGAGCACTAAAGGAGATTTCTTAGTATCTTGTGGTTTAGATTAAACA
ACAAGAATTATCACTTAATCTTCTTAAACTCAATCCTGGCATGAAATTTCTCGTGCATAA
ATTCACGGTTACGATATCAATAGCATTAAATGCTATCCTGTTTAACTTGAAAATAAAAAT
ATTTGTGACACTCTTATTTGCGGAGCTGACGAAAAAGTTGTTAGATTATTTGAACCTCCT
GCAGCTTTTGTGAATGCAGTTAATCAAATGTCCAACACAGATTTACATTTATACTTCTAA
GACGATAATCAAGAAAAGAAATATTTGGATTAAAAGCAGTTAGAAAAGGGTATCTTTGAA
TACCAAGTTTCCTAAGAAGGTGGTGCTCAAGTTCTCGGTCTTATGATTAAAGCTATTAAA
CTTGAACCAGATTTTGACCCTTCTAAATACGTAGATCCTGAAGATGAAGGTGGTTTGATT
TCAGATAAAATTTAATCTATTGAAGATAAAAAGAAAGAAGAAGAACTTTTTTCTTAGAAG
CACGATTTTACTCAACCTCCTATTGAAGATTACTTGATAAAGCATACCTTATGGCCTGAA
TTGAATAAGTTATATGGACATGGTTATGAATTAAAGTGTGTCAGCTGCAGCAATGATGGC
AAATTAATTGCAAGTTGCTCAAAATCTTAAACAAAAGAAAATGCATGTGTGATTTTCTGG
AATCCTACTAACTATTAAATTTATTCCAAGTTAGAATATCACAATTTCACTATTAACCAG
ATGGAATTCTCACCCAGTGATGAATACTTTGCAACTGTTTCCAAAGATAGATCTTTAGCA
TTATTTAAAAAGAATTATCTTGACGAAGCTAAAAAGGAATTAAACTTCAAAGAACCTTAC
GCTCTATACTATAATGATAAATCCCATACAAGAATTATTTATAGCGCAGCTTTCTCACAT
GATGAGAAATTTATTGCCACAGGTGCAAGAGATAAGAGAATCAAAATTCACTCAATATTA
GATAAAAAGGTTATATTTAATAAAGTATTAAGTAGCACTATTACTGCATTAGCATTTGCT
CCTATATCATATAAAAATGAAAACTCATACCTTATTATTGTTGGCTACGAAGAAGGAGGA
ATGGAATTATATGAATTCGAAAGTAACACTAATCAACTCAATCTGATTGATAAGCCACAC
GAGTTTATCGGACATACAAATACAATCAGTAGGATTAAATTCAGAAAGAATTATAAGCCT
AACATTAACAGCAAAATTCTTCAATTTGCTACTTGTTCACTTGATCACACAGTCCGTGTT
TTCAATTTCAAGATTAATTGA


>TTHERM_00312230(gene)
ATGAGTCAATTAGAATTAAGCTGCGTTTAAGGAGGTGTTAACCCCCTTTATAAATGTTTT
GCCTTAGGCAAAGCTGTTAAGGAAGCTTGCTTTTATGCTTGCTCCAATAGCATTATTGTG
AACAATATCAATAAGGTTACTAATTATTTTACTTTAAGTGGACATTCAGATCGCGTTAAC
TTTGTAAAAACTATAAATAATTTTTCTGAGCGTTAGCTTATTGTTTCAGGAAGCAGTGAT
TCCAATTTAATAATTTGGGAAGGTAAACTTTCTAACCTATTTATCAAGGAAAATTGGTCT
ATTAAGCATAAATTTAATCTCAATCACTCTGTTTCATTTGCCACTGTTTTAGAATACTCT
CCTAATCTTGCATATGTCGTAGCTGGTAATATTATGGGTGATGTCTATATTATAAAGATA
AGCGATGAATCTAATCAAAGTTTAATTATGGATAGCATCACATTTGGACATCATTTTACA
TAAGAATGCACTGCACTTATCCGCCACAATCCTAATAAAGATGAATTTTTGATAGCTTTA
GGAGGTTTAGACTTCACTGTTCATATCTATCACACTGATTTAAAGAAATATACAGCTCCA
GTAGATGGTAAAAATACTATGGAAAGAGGTACTTTGTTTGAATACAAAGTTAGTCTTAAA
GGACATGAAAATGCAATTACTGATTTGTAGGTCTTAAAACAAAAAAAAGACACTCATGAA
GAATGGATTATTGCCAGCTCTTCTAAAGATACTTATGTTCGTTTATGGAGATTTAGTGAG
CTCTTAGAAGATGAGACTATTAAGTAAATTTCTGAATTCTAAAATAAGCAAACTTAAAGA
TTCGTTTTAGGCGATAAGAAGTATTTTATCACTTTAGAAAGTGTTTTGAGCGGACACGGT
GAAGCAGTAGTCTGTCTTGACTGGGGTTTGTACAAAGGAGAAACTGCACTTATCTCTGCA
TCATTTGATTTTAACATTATATTATGGACCAAGGATAAAGACACAGGTAATAAAATAATT
CATCAATAAATAACCTTTTTATCATAAAAACAATGAATACATTTTATCCACACTATAATT
TTTATTTTAATTAAATTATTGAAAAATAAAATAGAATAATTATATATTTTTTCTATTTAT
AGATATTTGGTTAACCTCATACAGATTAGGTTAGGTAACAGGAAGCAAGTATGCCTTTTT
CCAAGCTACCTTTAATGCTGATTACACATAGATTTTTTCTTACACATACACAGGTTCATT
TTACTTATGGGAATACAATTAAGAAAAGGGAATTTGGGATTCTAAACCAACTGTTAGTGG
CCACTTCAATTAGGTATTTGATTTGGATTGGAGCACTAAAGGAGATTTCTTAGTATCTTG
TGGTTTAGATTAAACAACAAGAATTATCACTTAATCTTCTTAAACTCAATCCTGGCATGA
AATTTCTCGTGCATAAGTAAGTTTATTAAAATTGTAAAATAAATTAATCTAATAAATAAC
CCTTATTTAAAAGATTCACGGTTACGATATCAATAGCATTAAATGCTATCCTGTTTAACT
TGAAAATAAAAATATTTGTGACACTCTTATTTGCGGAGCTGACGAAAAAGTTGTTAGATT
ATTTGAACCTCCTGCAGCTTTTGTGAATGCAGTTAATCAAATGTCCAACACAGATTTACA
TTTATACTTCTAAGACGATAATCAAGAAAAGAAATATTTGGATTAAAAGCAGTTAGAAAA
GGGTATCTTTGAATACCAAGTTTCCTAAGAAGGTAAATTATTAATTCATTTTCATTTATT
TTTATATTTGAATAAAATTTTTTTAATCATTGATATGATTTTATCATTCACAAATTATTT
AAATTAATTTTACTTTTTAAATCTTATTTTAGGTGGTGCTCAAGTTCTCGGTCTTATGAT
TAAAGCTATTAAACTTGAACCAGATTTTGACCCTTCTAAATACGTAGATCCTGAAGATGA
AGGTGGTTTGATTTCAGATAAAATTTAATCTATTGAAGATAAAAAGAAAGAAGAAGAACT
TTTTTCTTAGAAGGTAAAAAATAATTTTTTTAATAAAAAAAATATTAATAATTGAAATAA
TAATTATAATTAATAAATTATAGCACGATTTTACTCAACCTCCTATTGAAGATTACTTGA
TAAAGCATACCTTATGGCCTGAATTGAATAAGTTATATGGACATGGTTATGAATTAAAGT
GTGTCAGCTGCAGCAATGATGGCAAATTAATTGCAAGTTGCTCAAAATCTTAAACAAAAG
AAAATGCATGTGTGATTTTCTGGAATCCTACTAACTATTAAATTTATTCCAAGTTAGAAT
ATCACAATTTCACTATTAACCAGATGGAATTCTCACCCAGTGATGAATACTTTGCAACTG
TTTCCAAAGATAGATCTTTAGCATTATTTAAAAAGAATTATCTTGACGAAGCTAAAAAGG
AATTAAACTTCAAAGAACCTTACGCTCTATACTATAATGATAAATCCCATACAAGAATTA
TTTATAGCGCAGCTTTCTCACATGATGAGAAATTTATTGCCACAGGTGCAAGAGATAAGA
GAATCAAAATTCACTCAATATTAGATAAAAAGGTTATATTTAATAAAGTATTAAGTAGCA
CTATTACTGCATTAGCATTTGCTCCTATATCATATAAAAATGAAAACTCATACCTTATTA
TTGTTGGCTACGAAGAAGGAGGAATGGAATTATATGAATTCGAAAGTAACACTAATCAAC
TCAATCTGATTGATAAGCCACACGAGTTTATCGGACATACAAATACAATCAGTAGGATTA
AATTCAGAAAGAATTATAAGCCTAACATTAACAGCAAAATTCTTCAATTTGCTACTTGTT
CACTTGATCACACAGTCCGTGTTTTCAATTTCAAGATTAATTGA


>TTHERM_00312230(protein)
MSQLELSCVQGGVNPLYKCFALGKAVKEACFYACSNSIIVNNINKVTNYFTLSGHSDRVN
FVKTINNFSERQLIVSGSSDSNLIIWEGKLSNLFIKENWSIKHKFNLNHSVSFATVLEYS
PNLAYVVAGNIMGDVYIIKISDESNQSLIMDSITFGHHFTQECTALIRHNPNKDEFLIAL
GGLDFTVHIYHTDLKKYTAPVDGKNTMERGTLFEYKVSLKGHENAITDLQVLKQKKDTHE
EWIIASSSKDTYVRLWRFSELLEDETIKQISEFQNKQTQRFVLGDKKYFITLESVLSGHG
EAVVCLDWGLYKGETALISASFDFNIILWTKDKDTDIWLTSYRLGQVTGSKYAFFQATFN
ADYTQIFSYTYTGSFYLWEYNQEKGIWDSKPTVSGHFNQVFDLDWSTKGDFLVSCGLDQT
TRIITQSSQTQSWHEISRAQIHGYDINSIKCYPVQLENKNICDTLICGADEKVVRLFEPP
AAFVNAVNQMSNTDLHLYFQDDNQEKKYLDQKQLEKGIFEYQVSQEGGAQVLGLMIKAIK
LEPDFDPSKYVDPEDEGGLISDKIQSIEDKKKEEELFSQKHDFTQPPIEDYLIKHTLWPE
LNKLYGHGYELKCVSCSNDGKLIASCSKSQTKENACVIFWNPTNYQIYSKLEYHNFTINQ
MEFSPSDEYFATVSKDRSLALFKKNYLDEAKKELNFKEPYALYYNDKSHTRIIYSAAFSH
DEKFIATGARDKRIKIHSILDKKVIFNKVLSSTITALAFAPISYKNENSYLIIVGYEEGG
MELYEFESNTNQLNLIDKPHEFIGHTNTISRIKFRKNYKPNINSKILQFATCSLDHTVRV
FNFKIN