Identifiers and Description

Gene Model Identifier

TTHERM_00313140

Standard Name

AAP2 (Ada2-associated protein 2)

Aliases

PreTt03501 | 30.m00310 | 3810.m01922 | A2A2

Description

PHD zinc finger protein; Member of the SAGA complex. PHD finger-containing protein.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03335.1 9.997093137033517e-262
Description: PHD-finger family protein (813 aa)
Oxytricha Contig3237.0.g25 0.000000000000004001928599951003
Description: PHD-finger
WormBase WBGene00003034 0.000000000003001226732525078
Description: locus:lin-49 Protein lin-49 status:Confirmed UniProt:Q20318 protein_id:CCD67656.1
SGD YPR031W 0.000000009996807949091551
Description: NTO1 Subunit of the NuA3 histone acetyltransferase complex that acetylates histone H3; contains PHD finger domain that interacts with methylated histone H3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00313140(coding)
ATGAATCCAGATAAATGCTAGATTTGTTCTTCTAATTATGCTAAGCATCTCTCTGTGATT
CCATATATTCACTCTGCATAGTAAAAAGGTGATCAAAATTAAGATAATAAATGTCATTTG
GTTTGCGCATCTTTCATTAAAGATGTAGAAATTAATATTAGAAATAAGCCAAAAAATAAA
TTTAAAATGGGTAAAAAGGAATTAATTGCAGAAACAAGTGTTAATTTAAAAAGTCTTGAA
TATAGTTAGCTTCTATGTTAAGATTGCAATGAAATCGATACAGAAACATACATTAAATGC
ATTGATGAAGATTGCAATAATTACTTTCATATTTCTTGCATTATCAAGAATCAAATCAAA
ATATCTCTTGGTAGATGGTCAGAAATAGATCGTAAAGCTTATTTACTTGAGCCTATTTGT
AGCGAACACATCAATAATAAAAAATATGTAGAGAAGTCAATTTCATGGTAAAATATTGAT
AAATAGCTGAAGCAAAAAATATTTGAAATGAATGGCCTAGATATCCAGTTGTTATCTGAT
GATGAAAGTGCAAGGGATTTAAAAAATATTTAGTTACAAGCAGGGAGAAAAGAGAGTCAT
TCTTAAAGTTAAGAGGACTCTTAATTAACTAAATTAGAAAGCAAGTCTGAAAGGAAATCT
CAAAGAAAAAGGAATCTTAAAATTAAATAAATAGATGAAAACACAACAATATCTAATTCT
GCAGCTGAATCAGCAGAGAGTTCTGATGTTGGAACACATTTATCTTCTATTTAGTACTCC
TCAGATTAAATAAAATCTAATTTGAAAAGCACATTAAAATAAAAAAAAGCTAAACTTTAA
ACAAAATAAATTGAAGAAAAGGTTAATAAAGGAGAATAAAAAAGTAGAGGTAGAAAAATA
AAAGAATTCAAAGAGGTAGAAATGGATTTAAATGAATAAAATGAGAAAGAAAGTATGACT
ATAATTGAGAAAGTATTCAAAAATAACACATTATTTAAAGATTGCTTAGATCCAACAAAA
TCTAAAGTTGCTGAAGAAATTATCAAAAAGAATAAAGTGAAAATTTCTGGAGGAATTCCT
TAATATCCTAACACTAATGACTCAAACAGATAAAACCTAATGAAGTAGTGGTGGAAATAT
GTGAATGATTTTTATTTTAAAGAGTGCTCGTAAAAAGATTTTTCTGCTCTCACTCAAGAA
AAAATGTCAAGTCTTTTAGATTTAGAGGATCTAGAAGATAATATGCCTCAATCAAGAGCT
TACAGATATGAAAAATTTATTTTGAAAAGTTAATATTACTAATCTTTGATTGAAAACGAC
TATTACTTAAATGGAATAGTACCAAGTTTAAAAAATCATTACTACTTAACAGTGTTATTT
GAAAACGATTCTTCTAATTTTTTAGTAAAATATGAATTGCTTGACTAAACTTTTAAAAAT
AAAATTCTGGATTCATTAAAAAGCTCTTAGAAGAATTAAATAAATAATTTAAATTTAAAT
ATTATAAGCCAAAGAGAAATGAATGATATTGCAGTAGTAAAACCTAAAAATTACTAAAGT
TATGCTACAAATTTTAATAGTAATATATCCAGCAGTGATTTATAGAGTATTTTGTATTTA
AGTGATATTTAAGGAGTTGACTGTTTATCTCTTTAAAAATCGATTGAATGCACAAAATTT
GTACTTGACCAACAAAATTAATACAGTTAATCATAAAATTATTCAAAGTAACTGTTACTG
TGTGAAGGGAACTAGAAAAATCAAATAAAATAAATTCCCATTTAAGATTAGAGAACAAAT
ATTTCAGAAGATTCGAGCTAGGAAGAAAGTGTTAGATAGCCAAATCAAATTGAACTTGAA
ATACTTTATTGGTAAGAATAGTTGTAATAAGTTTTAGATGAAAATAACAATGGAAAAAGA
AGAATTTTAGATAACCTTTAAAATGAATAAAATAAGTACTTGTAAATAGAAGATTTGGAA
AGAGAAAGCAGGAAAGTTTACGATATAGTAAAATGGAATACAATTATCAGATATATGAAA
GTAGGATATGGAGAAAAAAGTGAAGAAATCCTATTAACATACATAAAAAATGAAAATTTA
GAGGATATCAGAGACCAAAAAAAAGAAATTTGTGAAGAAATTGATTAAATTCTAGAAAAA
TCAGAAGACAAAAATACAAATTAAGGAATGTTTCATGCCAAAGGTGGTAAAAATACTTGG
AGAAGCAAGATATTTTAGTAAATTTGCTTAAGAAACACTGATGGGTATATTGAAATTGAT
TGTAAAATATGCTTCAATAATTATAGTAGTGAATCAAATCCTGTTGTTTACTGCTCACTT
TGTTCTGCATCTTTTCACTAATTTTGTTACGGCATTAAGGAGATTCCTCATGATGATTTT
TTGTGCGATTTATGTTTATTCAGATAGTCATAAGCCTAAAAAGAAAATATGAATAAATAA
ATCAGCAATTCTAACATTTAAGTTGAAATTTAAACCTAACAAAAAAAAAAAAAAAAGAAA
GAGCACAGATTATTATGTAAAATATGCTTAAAAACTGGTTTCCCGATGATCGATGTCAAC
CACTAATTTTACCATGTTTCTTGCTTGATATTTTTAAATTTGATATATATTAAAGACAGC
TGCATTTCTCTTAGAGGAGGGGAATCTGATGAAGATATGATTAAATTTTAATAAAACTTA
TTAGATATAGTTGTTAAAAATGAGCTATAAAATTACATGTGTGCAATTTGCTAGAAAAGA
TAAGGTTATAAAATAAAGTGCAATCATTGTGATTGCAATTTAGCATTTCATACTCACTGT
GCATACATAGAGGGATTATATTTTGATATTGAAATATTATAACCTGAGTAACAAAATAAG
AATTTAAATGAAAATGGTATTGACAACAATACAATAAAATCCTATACATCTTTAGACGAA
AATTCTATAGACGATAATTTTAACAAAATCTAAACATCTATTTACTGCCCAAGTCATCAA
CCAATTCAAGACAGAGACGAAATTTTATAAATTTACTTACGTAGATATGGAATAAATCTT
TATTAAACAGCAGTTGAATACAAAGATTATAACTCTTTCATCGCTGATCATGAAAATATT
TAAAAAGAATCAAAATAAAAAATAGAAGAAATTAGATCTAAAATTCAATAAGAAAATTAA
GTGAGCTATGAAAGTACAAGTGGAATATTTAAGCTTTTAAATGACTGTACAAGTAATTAA
GAAATAGATATTACTGATATTTTTGGTGATTTAAATGAGAATAGTATAAACCAAAATAAT
AACCATGTTGAAACACAAAATAGTAATTCAAATTAAATCAAAAATATTGAAAAAAGTATC
TCCAACAACAAATAATAAAATACTAAAAATGACAATTGTTCAAAATCAAATATCAAGATT
GATTAAATGAATTCTCTTTTGAAGGCATAATCAAAAGAAAACGACAAGTATATTATAAAT
ACAACAAGTTAACTACAATAAATAAAAAAAGAAAATTATTACAATTAAAATATCTCTTAA
AATAACTGCATAACAAAGAACGAAACTTATCTTAAACAATAATAAAAGTAGAACAATTCT
TAGAATAAATGTTTATAATAAATTAACAATAATAAAAAATAAAGCACTTAGAATAATAAT
TATCAAAATACTTCTTCTATTTCTTAGTTTCAAAACAAAAATAATTCCAACTCCTAAAAA
AGTAGTTAAATATCATCTAATCAATTATAAGAATAATAAATTGATGCTAGCAAATTGATT
TCTGAAATATTTTCAGACTGA


>TTHERM_00313140(gene)
ATGAATCCAGATAAATGCTAGATTTGTTCTTCTAATTATGCTAAGCATCTCTCTGTGATT
CCATATATTCACTCTGCATAGTAAAAAGGTGATCAAAATTAAGATAATAAATGTCATTTG
GTTTGCGCATCTTTCATTAAAGATGTAGAAATTAATATTAGAAATAAGCCAAAAAATAAA
TTTAAAATGGGTAAAAAGGAATTAATTGCAGAAACAAGTGTTAATTTAAAAAGTCTTGAA
TATAGTTAGCTTCTATGTTAAGATTGCAATGAAATCGATACAGAAACATACATTAAATGC
ATTGATGAGTAAATATTAATTTAAATTATTTAAAAATGATTCTTGATTTGAAACTTATAA
AAAGAAAAATGTCATCAAATAGTCTATAAAATCATATAATTTTTTGAGCTAAAATAATTT
GTAAAGAAAATAATGGTTTCTAATTTTTAAATTTATAAAATAACAAAAGAGATTGCAATA
ATTACTTTCATATTTCTTGCATTATCAAGAATCAAATCAAAATATCTCTTGGTAGATGGT
CAGAAATAGATCGTAAAGCTTATTTACTTGAGCCTATTTGTAGCGAACACATCAATAATA
AAAAATGTACATTTATCTATTTTGAAATTTTCATGATTCTTGAGAAAAATGCTCTATTAT
GCATTTTAAAAAGTTTAGATTATAGCTTTAATATTTAAATATTATTTAGATGTAGAGAAG
TCAATTTCATGGTAAAATATTGATAAATAGCTGAAGCAAAAAATATTTGAAATGAATGGC
CTAGATATCCAGTTGTTATCTGATGATGAAAGTGCAAGGGATTTAAAAAATATTTAGTTA
CAAGCAGGGAGAAAAGAGAGTCATTCTTAAAGTTAAGAGGACTCTTAATTAACTAAATTA
GAAAGCAAGTCTGAAAGGAAATCTCAAAGAAAAAGGAATCTTAAAATTAAATAAATAGAT
GAAAACACAACAATATCTAATTCTGCAGCTGAATCAGCAGAGAGTTCTGATGTTGGAACA
CATTTATCTTCTATTTAGTACTCCTCAGATTAAATAAAATCTAATTTGAAAAGCACATTA
AAATAAAAAAAAGCTAAACTTTAAACAAAATAAATTGAAGAAAAGGTTAATAAAGGAGAA
TAAAAAAGTAGAGGTAGAAAAATAAAAGAATTCAAAGAGGTAGAAATGGATTTAAATGAA
TAAAATGAGAAAGAAAGTATGACTATAATTGAGAAAGTATTCAAAAATAACACATTATTT
AAAGATTGCTTAGATCCAACAAAATCTAAAGTTGCTGAAGAAATTATCAAAAAGAATAAA
GTGAAAATTTCTGGAGGAATTCCTTAATATCCTAACACTAATGACTCAAACAGATAAAAG
TATTTAATTTAAATAGATTTTAATTCTATAAATAATTCATTAATTATAATTAAATGCTAA
AATAAATAGCCTAATGAAGTAGTGGTGGAAATATGTGAATGATTTTTATTTTAAAGAGTG
CTCGTAAAAAGATTTTTCTGCTCTCACTCAAGAAAAAATGTCAAGTCTTTTAGATTTAGA
GGATCTAGAAGATAATATGCCTCAATCAAGAGCTTACAGATATGAAAAATTTATTTTGAA
AAGTAATACTTTTTATAAAAGTTTACATATTAATAATAATTATTTTTTATAGGTTAATAT
TACTAATCTTTGATTGAAAACGACTATTACTTAAATGGAATAGTACCAAGTTTAAAAAAT
CATTACTACTTAACAGTGTTATTTGAAAACGATTCTTCTAATTTTTTAGTAAAATATGAA
TTGCTTGACTAAACTTTTAAAAATAAAATTCTGGATTCATTAAAAAGCTCTTAGAAGAAT
TAAATAAATAATTTAAATTTAAATATTATAAGCCAAAGAGAAATGAATGATATTGCAGTA
GTAAAACCTAAAAATTACTAAAGTTATGCTACAAATTTTAATAGTAATATATCCAGCAGT
GATTTATAGAGTATTTTGTATTTAAGTGATATTTAAGGAGTTGACTGTTTATCTCTTTAA
AAATCGATTGAATGCACAAAATTTGTACTTGACCAACAAAATTAATACAGTTAATCATAA
AATTATTCAAAGTAACTGTTACTGTGTGAAGGGAACTAGAAAAATCAAATAAAATAAATT
CCCATTTAAGATTAGAGAACAAATATTTCAGAAGATTCGAGCTAGGAAGAAAGTGTTAGA
TAGCCAAATCAAATTGAACTTGAAATACTTTATTGGTAAGAATAGTTGTAATAAGTTTTA
GATGAAAATAACAATGGAAAAAGAAGAATTTTAGATAACCTTTAAAATGAATAAAATAAG
TACTTGTAAATAGAAGATTTGGAAAGAGAAAGCAGGAAAGTTTACGATATAGTAAAATGG
AATACAATTATCAGATATATGAAAGTAGGATATGGAGAAAAAAGTGAAGAAATCCTATTA
ACATACATAAAAAATGAAAATTTAGAGGATATCAGAGACCAAAAAAAAGAAATTTGTGAA
GAAATTGATTAAATTCTAGAAAAATCAGAAGACAAAAATACAAATTAAGGAATGTTTCAT
GCCAAAGGTGGTAAAAATACTTGGAGAAGCAAGATATTTTAGTAAATTTGCTTAAGAAAC
ACTGATGGGTATATTGAAATTGATTGTAAAATATGCTTCAATAATTATAGTAGTGAATCA
AATCCTGTTGTTTACTGCTCACTTTGTTCTGCATCTTTTCACTAATTTTGTTACGGCATT
AAGGAGATTCCTCATGATGATTTTTTGTGCGATTTATGTTTATTCAGATAGTCATAAGCC
TAAAAAGAAAATATGAATAAATAAATCAGCAATTCTAACATTTAAGTTGAAATTTAAACC
TAACAAAAAAAAAGTAATTTTATTTTTATTAATATATTTGAATGAATGAATGAATGAATA
TAATAAATTTAACATAGAAAAAAAGAAAGAGCACAGATTATTATGTAAAATATGCTTAAA
AACTGGTTTCCCGATGATCGATGTCAACCACTAATTTTACCATGTTTCTTGCTTGATATT
TTTAAATTTGATATATATTAAAGACAGCTGCATTTCTCTTAGAGGAGGGGAATCTGATGA
AGATATGATTAAATTTTAATAAAACTTATTAGATATAGTTGTTAAAAATGAGCTATAAAA
TTACATGTGTGCAATTTGCTAGAAAAGATAAGGTTATAAAATAAAGTGCAATCATTGTGA
TTGCAATTTAGCATTTCATACTCACTGTGCATACATAGAGGGATTATATTTTGATATTGA
AATATTATAACCTGAGTAACAAAATAAGAATTTAAATGAAAATGGTATTGACAACAATAC
AATAAAATCCTATACATCTTTAGACGAAAATTCTATAGACGATAATTTTAACAAAATCTA
AACATCTATTTACTGCCCAAGTCATCAACCAATTCAAGTATTTTAAAATCAATCAATCAG
TATTTTAATTTTATTTAATTTTTATTTAATTATCAGGACAGAGACGAAATTTTATAAATT
TACTTACGTAGATATGGAATAAATCTTTATTAAACAGCAGTTGAATACAAAGATTATAAC
TCTTTCATCGCTGATCATGAAAATATTTAAAAAGAATCAAAGTAAGAAATTTTTTAAAAG
ACATTTGTTTATTTATTAAATTTATTTTTGAAATTAAGATAAAAAATAGAAGAAATTAGA
TCTAAAATTCAATAAGAAAATTAAGTGAGCTATGAAAGTACAAGTGGAATATTTAAGCTT
TTAAATGTAATCAAATTTGATTTAAAAATTTTATAATATGTAATAATAAATTTTATTTTA
TAGGACTGTACAAGTAATTAAGAAATAGATATTACTGATATTTTTGGTGATTTAAATGAG
AATAGTATAAACCAAAATAATAACCATGTTGAAACACAAAATAGTAATTCAAATTAAATC
AAAAATATTGAAAAAAGTATCTCCAACAACAAATAATAAAATACTAAAAATGACAATTGT
TCAAAATCAAATATCAAGATTGATTAAATGAATTCTCTTTTGAAGGCATAATCAAAAGAA
AACGACAAGTATATTATAAATACAACAAGTTAACTACAATAAATAAAAAAAGAAAATTAT
TACAATTAAAATATCTCTTAAAATAACTGCATAACAAAGAACGAAACTTATCTTAAACAA
TAATAAAAGTAGAACAATTCTTAGAATAAATGTTTATAATAAATTAACAATAATAAAAAA
TAAAGCACTTAGAATAATAATTATCAAAATACTTCTTCTATTTCTTAGTTTCAAAACAAA
AATAATTCCAACTCCTAAAAAAGTAGTTAAATATCATCTAATCAATTATAAGAATAATAA
ATTGATGCTAGCAAATTGATTTCTGAAATATTTTCAGACTGA


>TTHERM_00313140(protein)
MNPDKCQICSSNYAKHLSVIPYIHSAQQKGDQNQDNKCHLVCASFIKDVEINIRNKPKNK
FKMGKKELIAETSVNLKSLEYSQLLCQDCNEIDTETYIKCIDEDCNNYFHISCIIKNQIK
ISLGRWSEIDRKAYLLEPICSEHINNKKYVEKSISWQNIDKQLKQKIFEMNGLDIQLLSD
DESARDLKNIQLQAGRKESHSQSQEDSQLTKLESKSERKSQRKRNLKIKQIDENTTISNS
AAESAESSDVGTHLSSIQYSSDQIKSNLKSTLKQKKAKLQTKQIEEKVNKGEQKSRGRKI
KEFKEVEMDLNEQNEKESMTIIEKVFKNNTLFKDCLDPTKSKVAEEIIKKNKVKISGGIP
QYPNTNDSNRQNLMKQWWKYVNDFYFKECSQKDFSALTQEKMSSLLDLEDLEDNMPQSRA
YRYEKFILKSQYYQSLIENDYYLNGIVPSLKNHYYLTVLFENDSSNFLVKYELLDQTFKN
KILDSLKSSQKNQINNLNLNIISQREMNDIAVVKPKNYQSYATNFNSNISSSDLQSILYL
SDIQGVDCLSLQKSIECTKFVLDQQNQYSQSQNYSKQLLLCEGNQKNQIKQIPIQDQRTN
ISEDSSQEESVRQPNQIELEILYWQEQLQQVLDENNNGKRRILDNLQNEQNKYLQIEDLE
RESRKVYDIVKWNTIIRYMKVGYGEKSEEILLTYIKNENLEDIRDQKKEICEEIDQILEK
SEDKNTNQGMFHAKGGKNTWRSKIFQQICLRNTDGYIEIDCKICFNNYSSESNPVVYCSL
CSASFHQFCYGIKEIPHDDFLCDLCLFRQSQAQKENMNKQISNSNIQVEIQTQQKKKKKK
EHRLLCKICLKTGFPMIDVNHQFYHVSCLIFLNLIYIKDSCISLRGGESDEDMIKFQQNL
LDIVVKNELQNYMCAICQKRQGYKIKCNHCDCNLAFHTHCAYIEGLYFDIEILQPEQQNK
NLNENGIDNNTIKSYTSLDENSIDDNFNKIQTSIYCPSHQPIQDRDEILQIYLRRYGINL
YQTAVEYKDYNSFIADHENIQKESKQKIEEIRSKIQQENQVSYESTSGIFKLLNDCTSNQ
EIDITDIFGDLNENSINQNNNHVETQNSNSNQIKNIEKSISNNKQQNTKNDNCSKSNIKI
DQMNSLLKAQSKENDKYIINTTSQLQQIKKENYYNQNISQNNCITKNETYLKQQQKQNNS
QNKCLQQINNNKKQSTQNNNYQNTSSISQFQNKNNSNSQKSSQISSNQLQEQQIDASKLI
SEIFSD